DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30287 and AgaP_AGAP008911

DIOPT Version :9

Sequence 1:NP_726083.1 Gene:CG30287 / 246530 FlyBaseID:FBgn0050287 Length:284 Species:Drosophila melanogaster
Sequence 2:XP_319658.4 Gene:AgaP_AGAP008911 / 1279878 VectorBaseID:AGAP008911 Length:579 Species:Anopheles gambiae


Alignment Length:311 Identity:83/311 - (26%)
Similarity:132/311 - (42%) Gaps:67/311 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 QLLLLIALVFL--KVQGQPHLLDPQCVTARSEPGLYRVINGKPADLFSNPWMVIIIERGMMK--- 66
            |.|||:..::|  :::||.   :.|.:..|.:.....:.|...|.....||...|..|...|   
Mosquito     7 QYLLLMGCLYLVTQIRGQD---EDQLLCGRRKVQTNSMNNNGDAIAGHWPWYAAIYHRKGEKQEY 68

  Fly    67 -CGGSLITPRYVLTAAHCKSE-----TKSQLTVRLGDYDVNQAVDCSSYGCIPRPREINVTRTYV 125
             ||||::....:|||::|...     :.:.:||.:|.....||   |:|..:...|||.|     
Mosquito    69 ACGGSILDETTILTASNCVYTPSGVISAALVTVHVGQIHPKQA---SAYAQMYDVREIVV----- 125

  Fly   126 PSHYTNFRK----NDIALLRLET----TVQYGDNIRSICLLMGDYTWS-SNILKNLVKFNTT--G 179
               :..|.:    |||||::|..    |.:|   ::.:||      |: .:.|:.:|..|.|  |
Mosquito   126 ---HPGFSEASTINDIALIKLTASITLTTEY---VQPVCL------WTMDSALELIVGRNGTVVG 178

  Fly   180 WGRTESR--INSPVLQQASLTHHHLSYC----AQVFGKQLDKSHIC---VASSTGSTCQGDSGGP 235
            :|..|.|  ::...||||::.......|    ..:||..|.....|   :.:..|: |.||||..
Mosquito   179 FGPNERRDVVSGEQLQQATIGVVDPQTCIASDPAIFGTHLPVETFCGKGLQNGAGA-CNGDSGDG 242

  Fly   236 LTARVRIGSERRVILFGVV--------SYGAVHCFGPTVYTNVIHFANWIE 278
            |...|    ..:..:.|:|        |.|.......||||:|..:.:||:
Mosquito   243 LFFEV----SGQWFVRGLVARLQPVRESDGLCDPLQYTVYTDVAKYVDWIK 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30287NP_726083.1 Tryp_SPc 41..277 CDD:214473 72/272 (26%)
Tryp_SPc 42..280 CDD:238113 74/274 (27%)
AgaP_AGAP008911XP_319658.4 Tryp_SPc 359..573 CDD:304450
Tryp_SPc 46..290 CDD:238113 73/269 (27%)
Tryp_SPc 46..288 CDD:214473 71/266 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.