DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30287 and AgaP_AGAP008891

DIOPT Version :9

Sequence 1:NP_726083.1 Gene:CG30287 / 246530 FlyBaseID:FBgn0050287 Length:284 Species:Drosophila melanogaster
Sequence 2:XP_319638.4 Gene:AgaP_AGAP008891 / 1279859 VectorBaseID:AGAP008891 Length:395 Species:Anopheles gambiae


Alignment Length:234 Identity:78/234 - (33%)
Similarity:112/234 - (47%) Gaps:32/234 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 CGGSLITPRYVLTAAHCKSETKS--QLTVRLGDYDVNQAVDCSSYGCIPRPREINVTRTYVPSHY 129
            |||||||.::|||||||.::..:  ..||||.|.|:....|......||..|.|.     .|.:.
Mosquito    87 CGGSLITWKFVLTAAHCSADLDNIPPDTVRLADTDLASTSDDEFAQQIPIARIIK-----HPQYR 146

  Fly   130 TNFRKNDIALLRLETTVQYGDNIRSICL-----LMGDYTWSSNILKNLVKFNTTGWGRTESRINS 189
            .:.:..|||::.||..|:....|...||     :.||       |.:.|.|...|:|   .|::|
Mosquito   147 WSRKYYDIAVVELEEYVKPNKVICVACLWREPNVPGD-------LMDAVGFGALGFG---ERLSS 201

  Fly   190 PVLQQASLTHHHLSYCA-------QVFGKQLDKSHICVASSTGSTCQGDSGGPL-TARVRIGSER 246
             .||:..|.....:.||       :...:.|....:|..|:|..||:||||||| |.|..:..:.
Mosquito   202 -TLQKIKLQALDETICAKRLPAMRREMPEGLRDDQLCAHSATMDTCEGDSGGPLQTDRTDLLGKT 265

  Fly   247 RVILFGVVSYGAVHCFGPT-VYTNVIHFANWIELHTKKN 284
            ..::.|||::|.....|.| |||.|..:.:|||...|::
Mosquito   266 YALIVGVVAFGTPCTNGSTGVYTRVSSYLDWIEEEVKES 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30287NP_726083.1 Tryp_SPc 41..277 CDD:214473 74/225 (33%)
Tryp_SPc 42..280 CDD:238113 77/228 (34%)
AgaP_AGAP008891XP_319638.4 Tryp_SPc 57..297 CDD:214473 74/225 (33%)
Tryp_SPc 59..299 CDD:238113 76/227 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.