DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30287 and CG43336

DIOPT Version :9

Sequence 1:NP_726083.1 Gene:CG30287 / 246530 FlyBaseID:FBgn0050287 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_001247122.1 Gene:CG43336 / 12798414 FlyBaseID:FBgn0263041 Length:279 Species:Drosophila melanogaster


Alignment Length:273 Identity:99/273 - (36%)
Similarity:138/273 - (50%) Gaps:8/273 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLLIALVF--LKVQGQPHLLDPQCVTARSEPGLYRVINGKPADLFSNPWMVIIIER-GMMKCGGS 70
            ::::.|.|  |.:.|....||..|......|.:.||.||..|.|.|:|||..:... |...||||
  Fly     3 VVVVGLTFFLLPLLGSTQFLDMACGIRAHSPSVPRVKNGTVASLTSSPWMAFLHSTDGRFICGGS 67

  Fly    71 LITPRYVLTAAHCKSETKSQLTVRLGDYDVNQAVDCSSYGCIPRPREINVTRTYVPSHYTNF-RK 134
            |||.|.|||||||..: :::|..|||:||..:...|....|..| .|..|.|.:...||... ..
  Fly    68 LITNRLVLTAAHCFLD-RTELVARLGEYDREEYEMCHDSYCTYR-IEAMVERGFRHRHYNPMTMA 130

  Fly   135 NDIALLRLETTVQYGDNIRSICLLMGDYTWSSNILKNLVKFNTTGWGRTESRINSPVLQQASLTH 199
            .|||:|||...|||.||||.||::: |..|...| .:|.....||||:|||..:|..|:...|..
  Fly   131 YDIAILRLYRKVQYTDNIRPICIVI-DPRWRKYI-DSLDPLTGTGWGKTESEGDSAKLRTVDLAR 193

  Fly   200 HHLSYCAQVFGKQLDKSHICVASSTGSTCQGDSGGPLTARVRIGSERRVILFGVVSYGAVHCFGP 264
            .|...|.:.....|..:..|..:...:.|.||||||:.|.:..|..:|.:..|:.|:....|...
  Fly   194 KHPEVCRRYATLSLTANQFCAGNERSNLCNGDSGGPVGALIPYGKSKRFVQVGIASFTNTQCVMV 258

  Fly   265 TVYTNVIHFANWI 277
            :|:|:|:.:.:||
  Fly   259 SVFTDVMSYVDWI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30287NP_726083.1 Tryp_SPc 41..277 CDD:214473 89/237 (38%)
Tryp_SPc 42..280 CDD:238113 90/238 (38%)
CG43336NP_001247122.1 Tryp_SPc 37..271 CDD:214473 89/237 (38%)
Tryp_SPc 40..271 CDD:238113 87/234 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.710

Return to query results.
Submit another query.