DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30287 and CG43124

DIOPT Version :9

Sequence 1:NP_726083.1 Gene:CG30287 / 246530 FlyBaseID:FBgn0050287 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_001247345.1 Gene:CG43124 / 12798282 FlyBaseID:FBgn0262587 Length:245 Species:Drosophila melanogaster


Alignment Length:273 Identity:75/273 - (27%)
Similarity:113/273 - (41%) Gaps:55/273 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLLLIALVFLKVQGQPHLLDPQCVTARSEPGLYRVINGKPADLFSNPWMVIIIERGMMKCGGSLI 72
            ::|.|.|:|  .||....|:..||.....      |||..    ..||:..|:....:.|.|:||
  Fly     7 IVLCIVLMF--YQGSAQTLEEDCVDHMER------INGSS----YAPWLAEILSDSKVICAGALI 59

  Fly    73 TPRYVLTAAHCKSETKSQLTVRLGD--YDVNQAVDCSSYGCIPRPREINVTRTYV-PSHYTNFRK 134
            ...||||||.|..|.: :||||||.  :|       .||      ....||:.|. .:|:.....
  Fly    60 NNLYVLTAASCFKENE-KLTVRLGSGYFD-------KSY------ENFRVTKAYFWMTHFPANNT 110

  Fly   135 NDIALLRLETTVQYGDNIRSICLLMGDYTWSSNILKNLVKFNTTGWGRTESRINSPVLQQASLTH 199
            |::.:.||:|.|::..:||.:|:....        |:|      |...|...||..........:
  Fly   111 NNLCIFRLQTEVEFKTHIRPMCITKSP--------KSL------GLATTFEIINEKPKMWYFCKN 161

  Fly   200 HHLSYCAQVFGKQLDKSHICVASSTGSTCQGDSGGPLTARVRIGSERRVILFGVVSYGAVHCFGP 264
            ....:|..|||:..:|..   :..|||        |.|..:..|..:.::.:|::||.....: .
  Fly   162 IKGLFCKYVFGENEEKWQ---SKPTGS--------PWTETISNGPFKGLVRYGILSYRDNKTY-D 214

  Fly   265 TVYTNVIHFANWI 277
            .||.||:...|||
  Fly   215 EVYINVMSHINWI 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30287NP_726083.1 Tryp_SPc 41..277 CDD:214473 64/238 (27%)
Tryp_SPc 42..280 CDD:238113 66/239 (28%)
CG43124NP_001247345.1 Tryp_SPc 41..>133 CDD:304450 35/105 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.