DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30287 and AgaP_AGAP009966

DIOPT Version :9

Sequence 1:NP_726083.1 Gene:CG30287 / 246530 FlyBaseID:FBgn0050287 Length:284 Species:Drosophila melanogaster
Sequence 2:XP_319102.4 Gene:AgaP_AGAP009966 / 1279386 VectorBaseID:AGAP009966 Length:288 Species:Anopheles gambiae


Alignment Length:254 Identity:71/254 - (27%)
Similarity:114/254 - (44%) Gaps:36/254 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 RVINGKPADLFSNPWMVIIIERGMMKCGGSLITPRYVLTAAHC-KSETKSQLTVRLGDYDVNQAV 104
            |::.|.|.|:...|:.| .:.||...||.|:|..:::|||||| ::.....|.:.:|...||...
Mosquito    45 RIVGGVPVDIRDYPYQV-SLRRGRHFCGESIIDSQWILTAAHCTRTINARNLWIHVGSSHVNDGG 108

  Fly   105 DCSSYGCIPRPREINVTRTYVPSHYTNFRKNDIALLRLETTVQYGDNIRSICLLMGDYTWSSNIL 169
            :           .:.|.|........::...|.:||.|:..:...::::.|.|.....:..:..|
Mosquito   109 E-----------SVRVRRILHHPKQNSWSDYDFSLLHLDQPLNLSESVQPIPLRKPSASEPTGEL 162

  Fly   170 KNLVKFNTTGWGRTESRINSPVLQQAS---LTHHHLSYCAQVFG--KQLDKSHICVASSTG--ST 227
            .:......:|||.|.:...|.::.:|:   ||:|  ..|::|:.  ..:.:|.||.....|  .:
Mosquito   163 SDGTLCKVSGWGNTHNPDESALVLRAATVPLTNH--QQCSEVYEGIGSVTESMICAGYDEGGKDS 225

  Fly   228 CQGDSGGPLTARVRIGSERRVILFGVVSYGAVHCFG---PTVYTNVIHFANWIE--LHT 281
            |||||||||....:        |.||||:|. .|..   |.||..|.....|||  :||
Mosquito   226 CQGDSGGPLVCDGQ--------LTGVVSWGK-GCAEPGYPGVYAKVSTAYEWIEQTVHT 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30287NP_726083.1 Tryp_SPc 41..277 CDD:214473 66/246 (27%)
Tryp_SPc 42..280 CDD:238113 68/250 (27%)
AgaP_AGAP009966XP_319102.4 Tryp_SPc 45..269 CDD:214473 66/246 (27%)
Tryp_SPc 46..272 CDD:238113 68/248 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.