DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30287 and AgaP_AGAP007795

DIOPT Version :9

Sequence 1:NP_726083.1 Gene:CG30287 / 246530 FlyBaseID:FBgn0050287 Length:284 Species:Drosophila melanogaster
Sequence 2:XP_317712.4 Gene:AgaP_AGAP007795 / 1278167 VectorBaseID:AGAP007795 Length:319 Species:Anopheles gambiae


Alignment Length:318 Identity:92/318 - (28%)
Similarity:132/318 - (41%) Gaps:74/318 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 AGAVQLLLLIALVFLKVQ---------GQPHLLDPQCVT-ARSE-PGLYRVINGKPADLFSNPWM 56
            |.|:||:||...:..::.         ||..:..|..:| .||. ||.:             ||.
Mosquito     4 ASALQLVLLALAIHWQIDSITTTNVLCGQRPIAAPGTITYGRSSWPGQF-------------PWH 55

  Fly    57 VIIIERGM-----MKCGGSLITPRYVLTAAHCKSE------TKSQLTVRLGDYDVNQAVDCSSYG 110
            |.:.....     ..|||.::..|.|:|||||.:.      ...:||||:|.||:......|   
Mosquito    56 VALYRTEQPLTISYACGGFIVGERVVITAAHCVTAPSGYQLAADELTVRVGLYDLLTLARHS--- 117

  Fly   111 CIPRPREINVTRTYVPSHY-TNFRKNDIALLRLETTVQYGDNIRSICLLMGDYTWSSNILKNLVK 174
                 :|..|.|.:...:: |...::|:|||.|.|.|::||.::.|||     ....:.||.:..
Mosquito   118 -----QEHRVGRIHRHGNFTTGSLRHDLALLMLRTIVEFGDFVQPICL-----PREPDALKGVRT 172

  Fly   175 FNTTGWGRTESRINSPVLQQASLTHHHLSY--CAQ----VFGKQLDKSHICVASSTG-STCQGDS 232
            ...:|||..|.  :||.....|.|...:||  |.|    :||..|.....|.....| :.|.|||
Mosquito   173 GTVSGWGLVED--DSPARTLRSATMPVVSYLSCLQSDSTLFGPVLYDGMFCAGWENGTNVCNGDS 235

  Fly   233 GGPLTARVRIGSERRVILFGVVSYGAV--HCFGPTV----------YTNVIHFANWIE 278
            ||...|.|. ||   ...||:||:..|  |..|.|.          :.::..:.||||
Mosquito   236 GGAFAANVN-GS---WTAFGIVSFTGVREHTDGQTPFRCDTKSLAGFISIPMYLNWIE 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30287NP_726083.1 Tryp_SPc 41..277 CDD:214473 75/266 (28%)
Tryp_SPc 42..280 CDD:238113 78/268 (29%)
AgaP_AGAP007795XP_317712.4 Tryp_SPc 41..291 CDD:238113 83/281 (30%)
Tryp_SPc 41..288 CDD:214473 80/278 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.