DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30287 and CLIPD2

DIOPT Version :9

Sequence 1:NP_726083.1 Gene:CG30287 / 246530 FlyBaseID:FBgn0050287 Length:284 Species:Drosophila melanogaster
Sequence 2:XP_317284.4 Gene:CLIPD2 / 1277787 VectorBaseID:AGAP008183 Length:512 Species:Anopheles gambiae


Alignment Length:280 Identity:86/280 - (30%)
Similarity:123/280 - (43%) Gaps:49/280 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 DPQ---CVTARSEPGLYRVINGKPADLFSNPWMVIIIERGMMKCGGSLITPRYVLTAAHCKSETK 88
            ||.   |......|...|::.|..||....||:..:...|...||||||...::||||||.:...
Mosquito   256 DPSNLGCGVKNGNPDTERIVGGHNADPNEWPWIAGLFNNGRQFCGGSLIDSIHILTAAHCVAHMS 320

  Fly    89 S----QLTVRLGDYDVNQAVDCS----SYGCIPRPREINVTRTYVPSHYTNFRKNDIALLRLETT 145
            |    :|:|:|||:::....:..    ....:.|.|..:....|          ||:|:|.::..
Mosquito   321 SYDVARLSVKLGDHNIRSNTEVQHVERRVKRLVRHRGFDSRTLY----------NDVAVLTMDQA 375

  Fly   146 VQYGDNIRSICLLMGDYTWSSNILKNLVKFNTTGWGRTESRINSP---VLQQASLTHHHLSYCAQ 207
            |.:...:|.|||...|.|.:.:.|...|    .|||  ..|.|.|   :||:.:|.....:.|..
Mosquito   376 VPFTKQVRPICLPAADSTRAYSGLTATV----IGWG--SLRENGPQPAILQEVNLPIWTNNECRI 434

  Fly   208 VFGKQ----LDKSHICVASSTGSTCQGDSGGPLTARVRIGSERRVILFGVVSYGAVHCFG----P 264
            .:|..    :..:.:|...:...:|.|||||||  .|..|...:|   ||||:| :.| |    |
Mosquito   435 KYGPAAPGGIIDTMLCAGQAAKDSCSGDSGGPL--MVNDGKWTQV---GVVSWG-IGC-GKGQYP 492

  Fly   265 TVYTNVIHFANWIELHTKKN 284
            .|||.|..|..||    |||
Mosquito   493 GVYTRVTAFLPWI----KKN 508

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30287NP_726083.1 Tryp_SPc 41..277 CDD:214473 77/254 (30%)
Tryp_SPc 42..280 CDD:238113 78/256 (30%)
CLIPD2XP_317284.4 Tryp_SPc 273..505 CDD:214473 77/254 (30%)
Tryp_SPc 274..508 CDD:238113 79/260 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.