DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30287 and TRY6_ANOGA

DIOPT Version :9

Sequence 1:NP_726083.1 Gene:CG30287 / 246530 FlyBaseID:FBgn0050287 Length:284 Species:Drosophila melanogaster
Sequence 2:XP_317175.2 Gene:TRY6_ANOGA / 1277692 VectorBaseID:AGAP008290 Length:273 Species:Anopheles gambiae


Alignment Length:257 Identity:71/257 - (27%)
Similarity:107/257 - (41%) Gaps:55/257 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 RVINGKPADLFSNPWMVIIIERGMMKCGGSLITPRYVLTAAHC---KSETKSQLTVRLGDYDVNQ 102
            |::.|...|:...|:.:.:...|...||||::..:::||||||   .||.|.  |||:|      
Mosquito    46 RIVGGFVIDISDAPYQISLQYNGKHHCGGSILNSKWILTAAHCIDLYSEVKP--TVRVG------ 102

  Fly   103 AVDCSSYGCIPRPREINVTRTYV-PSHYTNFRKNDIALLRLETTVQYGDNIRSICLLMGDYTWSS 166
            :.:.::.|.:     :::.|... |.|.:.....|||||.||..:.:.||::.:.|...|.....
Mosquito   103 SSEHAAGGTV-----LHLLRIVPHPGHSSGGNNYDIALLELECELTFNDNVQPVQLPEQDDPIDE 162

  Fly   167 NILKNLVKFNTTGWGRTES---------RINSPVLQQASLTHHHLSY---CAQVFGKQLDKSHIC 219
            ..: .:|    :|||.|.|         ..|.|.:.|......:.||   ..|:|         |
Mosquito   163 GTM-GIV----SGWGMTMSAADLNAILRATNVPTVNQQECNQAYQSYGGVAEQMF---------C 213

  Fly   220 VASSTG--STCQGDSGGPLTARVRIGSERRVILFGVVSYGAVHCFG--PTVYTNVIHFANWI 277
            .....|  .||:.|||||..|..:        |.||||:.......  |.||..|....:||
Mosquito   214 AGYKQGGTGTCRNDSGGPFVAEGK--------LIGVVSWSHECALAGYPGVYARVASVRDWI 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30287NP_726083.1 Tryp_SPc 41..277 CDD:214473 69/255 (27%)
Tryp_SPc 42..280 CDD:238113 70/256 (27%)
TRY6_ANOGAXP_317175.2 Tryp_SPc 46..267 CDD:214473 69/255 (27%)
Tryp_SPc 47..270 CDD:238113 70/256 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.