DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30287 and TRY5_ANOGA

DIOPT Version :9

Sequence 1:NP_726083.1 Gene:CG30287 / 246530 FlyBaseID:FBgn0050287 Length:284 Species:Drosophila melanogaster
Sequence 2:XP_317174.2 Gene:TRY5_ANOGA / 1277691 VectorBaseID:AGAP008291 Length:274 Species:Anopheles gambiae


Alignment Length:283 Identity:75/283 - (26%)
Similarity:123/283 - (43%) Gaps:39/283 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLLLIALVFLKVQGQPHLLDPQCVTARSEPGL--YRVINGKPADLFSNPWMVIIIERGMMKCGGS 70
            |..|:|....:.:.:..|..|....|.:.|.|  .|::.|...::...|:.:.:.......||||
Mosquito    12 LFALLAYARAQAERRHKLTRPVHRFAPNRPYLAGKRIVGGFVINISDAPYQISLQYDDDHNCGGS 76

  Fly    71 LITPRYVLTAAHC-KSETKSQLTVRLGDYDVNQAVDCSSYGCIPRPREINVTRTYVPSHYTNFRK 134
            :::.:::|||||| .....|:.|||:|      :...:|.|.:.|...|      || |..:..|
Mosquito    77 ILSSKWILTAAHCINDNAPSKPTVRVG------SSKHASGGTVIRVARI------VP-HPMHGSK 128

  Fly   135 N--DIALLRLETTVQYGDNIRSICLLMGDYTWSSNILKNLVKFNTTGWGRTESRINS-PVLQQAS 196
            |  |||||.|:..:.:.:.::.|.|...|.......: .:|    :|||.|.|..:| .||:..:
Mosquito   129 NNYDIALLELKNELTFSEKVQPIALPEQDEPIEEGTM-GIV----SGWGLTLSEADSNDVLRATN 188

  Fly   197 LTHHHLSYCAQVFGKQ---LDKSHICVASSTG--STCQGDSGGPLTARVRIGSERRVILFGVVSY 256
            :...:...|.:.:..:   :.....|.....|  .||:.|||||..|:.:        |.||:|:
Mosquito   189 VPTVNQQECNKAYQSRYGGITDQMFCAGYKQGGQDTCRQDSGGPFVAKGK--------LIGVISW 245

  Fly   257 GAVHCFG--PTVYTNVIHFANWI 277
            |......  |.||..|....:||
Mosquito   246 GHECALAGYPGVYARVASVRDWI 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30287NP_726083.1 Tryp_SPc 41..277 CDD:214473 65/246 (26%)
Tryp_SPc 42..280 CDD:238113 66/247 (27%)
TRY5_ANOGAXP_317174.2 Tryp_SPc 47..268 CDD:214473 65/246 (26%)
Tryp_SPc 48..271 CDD:238113 66/247 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.