DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30287 and AgaP_AGAP006539

DIOPT Version :9

Sequence 1:NP_726083.1 Gene:CG30287 / 246530 FlyBaseID:FBgn0050287 Length:284 Species:Drosophila melanogaster
Sequence 2:XP_316577.4 Gene:AgaP_AGAP006539 / 1277138 VectorBaseID:AGAP006539 Length:270 Species:Anopheles gambiae


Alignment Length:261 Identity:72/261 - (27%)
Similarity:116/261 - (44%) Gaps:49/261 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 RVINGKPADLFSNPWMVIIIERGMM---KCGGSLITPRYVLTAAHCKSETKSQL-TVRLGDYDVN 101
            |::||..|.:...|:|:.:  ||..   .||||:::..:.:|||||.|.|.:.| |:::|..:::
Mosquito    35 RIVNGTDASILDYPFMLSL--RGSTGGHSCGGSILSELWAMTAAHCVSSTTTYLQTIQVGRTNIS 97

  Fly   102 QAVDCSSYGCIPRPREINVTRTYVPSHY--TNFRKNDIALLRLETTVQYGDNIRSICLLMGDYTW 164
            :.||.|.||         :.:......|  .|...||||||:|:..:.:.::::.:.|....:  
Mosquito    98 RDVDDSVYG---------IAQVIAHPQYDSRNSHLNDIALLKLQRPIVFSESVQPVRLPAPMF-- 151

  Fly   165 SSNILKNLVKFNTT--GWGRTESRINSPVLQQASLTHHHLSY-------CAQVFGKQLDKSHICV 220
              .:..:|.....|  |||...:..::|.      |...:.|       |..:....:..||||.
Mosquito   152 --EVEDDLDDLGVTLIGWGLLATGGSAPA------TLQRVDYYVVPNEECNAIHTGTIYPSHICA 208

  Fly   221 ASSTG--STCQGDSGGPLTARVRIGSERRVILFGVVSYGAVHCF---GPTVYTNVIHFANWIELH 280
            |...|  ..|.|||||||.        ...:..|:||:....|.   .|.|.|.|.|...:|:.|
Mosquito   209 AIPGGGKGQCSGDSGGPLL--------HHGVQVGIVSWSVKPCAVAPYPGVLTKVSHHLEFIQQH 265

  Fly   281 T 281
            |
Mosquito   266 T 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30287NP_726083.1 Tryp_SPc 41..277 CDD:214473 69/255 (27%)
Tryp_SPc 42..280 CDD:238113 69/257 (27%)
AgaP_AGAP006539XP_316577.4 Tryp_SPc 35..262 CDD:214473 69/255 (27%)
Tryp_SPc 36..265 CDD:238113 69/257 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.