DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30287 and AgaP_AGAP004638

DIOPT Version :9

Sequence 1:NP_726083.1 Gene:CG30287 / 246530 FlyBaseID:FBgn0050287 Length:284 Species:Drosophila melanogaster
Sequence 2:XP_315174.5 Gene:AgaP_AGAP004638 / 1275890 VectorBaseID:AGAP004638 Length:330 Species:Anopheles gambiae


Alignment Length:337 Identity:93/337 - (27%)
Similarity:139/337 - (41%) Gaps:84/337 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VQLLLLIALVFLKVQGQPHLLDPQCVTARSE-----PGLYRVIN----------GKPAD--LFSN 53
            |.||||||::|  :.|.|.|      |.:.|     .||..::|          ..|.|  ||.:
Mosquito    14 VSLLLLIAIIF--IGGCPAL------TEKKENNLPNSGLLALVNQTCGTRYYESNFPVDTRLFEH 70

  Fly    54 PWMVII-IERGMM---KCGGSLITPRYVLTAAH-CKSETKSQLT-VRLGDYDVNQAVDCSSYG-- 110
            ||:|.. .||.::   ...|.||..:||||... .:.:...||. .|:|:::.:...||....  
Mosquito    71 PWLVQFGYERELVVNYVFQGLLIHSKYVLTTVFVVQFQDFGQLKYARVGEHNTSTNTDCEKLSLL 135

  Fly   111 ---CIPRPREINVTRTYVPSHYTNFRK-NDIALLRLE-TTVQYGDNIRSICLLMGDYTWSSNILK 170
               |.|..:.|.|....|...|..|.: |||||::|. ..:..|..:..|| :..|..:.|:.| 
Mosquito   136 EETCAPLAQSILVDEVIVHPDYNMFAQINDIALVKLRVAAIVDGTAVAPIC-VNDDLNYQSSFL- 198

  Fly   171 NLVKFNTTGW-GRTESRIN-----------SPVLQQASLTHHHLSYCAQVFGKQLDKSHICVASS 223
             ||    ..| ||.|:.::           ||...|..:..|.:|:...:|....|:.|      
Mosquito   199 -LV----ASWCGRRETGLSLVPKQYFMKPISPYECQRLMPRHSVSFANGMFCIVFDERH------ 252

  Fly   224 TGST-------CQGDSGGPLTARVRIGSERRVILFGVVSYG-----AVHCFGPTVYTNVIHFANW 276
            |.||       .:|.||.|:   ..:....|::|.|::|||     .:|  .|.|...|..|.:|
Mosquito   253 TNSTELAYEPNLRGGSGAPI---YTVHDGNRILLVGLLSYGPRYPAKLH--EPYVIIPVAPFYDW 312

  Fly   277 ----IELHTKKN 284
                ||...:|:
Mosquito   313 MTGVIEADREKH 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30287NP_726083.1 Tryp_SPc 41..277 CDD:214473 75/288 (26%)
Tryp_SPc 42..280 CDD:238113 77/290 (27%)
AgaP_AGAP004638XP_315174.5 Tryp_SPc 69..312 CDD:214473 69/260 (27%)
Tryp_SPc 69..312 CDD:304450 69/260 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.