DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30287 and AgaP_AGAP010546

DIOPT Version :9

Sequence 1:NP_726083.1 Gene:CG30287 / 246530 FlyBaseID:FBgn0050287 Length:284 Species:Drosophila melanogaster
Sequence 2:XP_314515.4 Gene:AgaP_AGAP010546 / 1275277 VectorBaseID:AGAP010546 Length:295 Species:Anopheles gambiae


Alignment Length:204 Identity:56/204 - (27%)
Similarity:89/204 - (43%) Gaps:28/204 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 CGGSLITPRYVLTAAHC--KSETKSQLTVRLGDYDVNQAVDCSSYGCIPRPREINVTRTY-VPSH 128
            ||||||...::||||||  ..|.......|:||.::....|...      |:::.:.:.. ...|
Mosquito    94 CGGSLIWENFILTAAHCAANDEDVPPDVARMGDLNIYSDDDDEF------PQQLRIVKVIRHQQH 152

  Fly   129 YTNFRKNDIALLRLETTVQYGDNIRSICLLMGDYTWSSNILKNLVKFNTTGWGRT---ESRINSP 190
            ..:.:..|:||::||..:...:.:...||.:.|..       ...|....|||||   |.:.|  
Mosquito   153 RFSAKYYDVALMQLEKNITVHETVAPACLWLDDEV-------RFPKLYAAGWGRTGFGEDKTN-- 208

  Fly   191 VLQQASLTHHHLSYCAQVFGKQ-------LDKSHICVASSTGSTCQGDSGGPLTARVRIGSERRV 248
            :|.:..||..:.:.|::.:...       |...|:|.......||.|||||||..::...::...
Mosquito   209 ILLKVDLTPMNNTQCSKFYTSSERGLRNGLHAHHLCAGDEKMDTCPGDSGGPLHVKLLHNAKMTP 273

  Fly   249 ILFGVVSYG 257
            .|.||.|:|
Mosquito   274 FLVGVTSFG 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30287NP_726083.1 Tryp_SPc 41..277 CDD:214473 56/204 (27%)
Tryp_SPc 42..280 CDD:238113 56/204 (27%)
AgaP_AGAP010546XP_314515.4 Tryp_SPc 67..295 CDD:214473 56/204 (27%)
Tryp_SPc 67..295 CDD:238113 56/204 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.