DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30287 and AgaP_AGAP005195

DIOPT Version :9

Sequence 1:NP_726083.1 Gene:CG30287 / 246530 FlyBaseID:FBgn0050287 Length:284 Species:Drosophila melanogaster
Sequence 2:XP_314094.4 Gene:AgaP_AGAP005195 / 1274901 VectorBaseID:AGAP005195 Length:250 Species:Anopheles gambiae


Alignment Length:299 Identity:74/299 - (24%)
Similarity:125/299 - (41%) Gaps:83/299 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 AGAVQLLLLIALVFLKVQGQPHLLDPQCVTARSEPGLYRVINGKPADLFSNPWMVIIIERGMMKC 67
            :|.|.|:||:.          |.|:...|    || |..:|.|...:....|::|.|.....: |
Mosquito     4 SGIVPLVLLVV----------HSLEASPV----EP-LAPIIGGSNVEDKKVPYLVSITVNSFV-C 52

  Fly    68 GGSLITPRYVLTAAHC-KSETKSQLTVRLGD---------YDVNQAVDCSSYGCIPRPREINVTR 122
            |||:|..|::|||||| |........||:..         |.:::|:                  
Mosquito    53 GGSIIADRWILTAAHCVKRNMVKNAAVRVETNNFTASGTLYRIDRAI------------------ 99

  Fly   123 TYVPSHYTNFR---KNDIALLRLETTVQYGDNIRSICLLMGDYTWSSNILKNLVKFNTT----GW 180
                :|...||   ::|:.||||.:.:::|:.::.|           .:|..:|.:|.|    |.
Mosquito   100 ----AHEKYFRGAFRDDVGLLRLRSPLKFGERVKKI-----------ELLSQIVPYNATLTLVGR 149

  Fly   181 GR-TESRINSPVLQQASLTHHHLSYCAQVFGKQLDKSHICVASSTG-STCQGDSGGPLTARVRIG 243
            |. ::....:.:.|.....:..|..|.::....:...|:|.....| .||.||||||:     :.
Mosquito   150 GYISKDNKTTKITQMIKAKNIALKLCRKMQPDFIYPGHLCTFVKKGKGTCSGDSGGPV-----VW 209

  Fly   244 SERRVILFGVVSY----GAVHCFGPTVYTNVIHFANWIE 278
            ..|:|   |:||:    ||.:.   .|::.:.:|..||:
Mosquito   210 YGRQV---GIVSWSKGCGAGYF---DVHSRISYFLPWIK 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30287NP_726083.1 Tryp_SPc 41..277 CDD:214473 61/258 (24%)
Tryp_SPc 42..280 CDD:238113 63/260 (24%)
AgaP_AGAP005195XP_314094.4 Tryp_SPc 28..244 CDD:238113 63/260 (24%)
Tryp_SPc 28..241 CDD:214473 61/257 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.