DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30287 and AgaP_AGAP004570

DIOPT Version :9

Sequence 1:NP_726083.1 Gene:CG30287 / 246530 FlyBaseID:FBgn0050287 Length:284 Species:Drosophila melanogaster
Sequence 2:XP_313874.5 Gene:AgaP_AGAP004570 / 1274709 VectorBaseID:AGAP004570 Length:259 Species:Anopheles gambiae


Alignment Length:257 Identity:83/257 - (32%)
Similarity:123/257 - (47%) Gaps:29/257 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 QCVTARSEPGLYRVINGKPADLFSNPWMVIIIERGMMKCGGSLITPRYVLTAAHCKSETK-SQLT 92
            :|..|..|   .|::.|:|..:...||:..::..|...||.||:|..||||||||....| :::.
Mosquito    12 ECGAANQE---IRIVGGRPTGVNQYPWLARLVYDGQFHCGASLLTKDYVLTAAHCVRRLKRNKIR 73

  Fly    93 VRLGDYDVNQAVDCSSYGCIPRPREINVTRTYVPSHYTNFRKNDIALLRLETTVQYGDNIRSICL 157
            |.|||||  |.|...:...:.....|...|::..:.|    .:|||||:|...|::...||.:| 
Mosquito    74 VILGDYD--QFVASETPAIMRAVTAIIRHRSFDQNSY----NHDIALLKLRKPVEFTKTIRPVC- 131

  Fly   158 LMGDYTWSSNILKNLVKFNTTGWGRTESRINSPVL-QQASLTHHHLSYCAQV--FGKQLDKSHIC 219
            |..:.:..:..|..:|     |||||......|.| |...:....|..|..:  ...::..:.:|
Mosquito   132 LPKERSEPAGQLGTVV-----GWGRTSEGGTLPALVQHVDVPILTLDQCRSMKYRASRITSNMLC 191

  Fly   220 VASSTGSTCQGDSGGPLTARVRIGSERRVILFGVVSYGAVHCFG----PTVYTNVIHFANWI 277
            .......:|||||||||.  ||.|.:..::  |:||:| |.| |    |.|||.|..:..|:
Mosquito   192 AGKGKQDSCQGDSGGPLL--VRNGDKHEIV--GIVSWG-VGC-GRAGYPGVYTRVARYLPWL 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30287NP_726083.1 Tryp_SPc 41..277 CDD:214473 79/243 (33%)
Tryp_SPc 42..280 CDD:238113 79/244 (32%)
AgaP_AGAP004570XP_313874.5 Tryp_SPc 21..246 CDD:214473 79/242 (33%)
Tryp_SPc 22..250 CDD:238113 79/244 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.