DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30287 and AgaP_AGAP004552

DIOPT Version :9

Sequence 1:NP_726083.1 Gene:CG30287 / 246530 FlyBaseID:FBgn0050287 Length:284 Species:Drosophila melanogaster
Sequence 2:XP_313850.5 Gene:AgaP_AGAP004552 / 1274693 VectorBaseID:AGAP004552 Length:349 Species:Anopheles gambiae


Alignment Length:284 Identity:90/284 - (31%)
Similarity:121/284 - (42%) Gaps:36/284 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 ALVFLKVQGQPHLLDPQCVTARSEPGLYRVINGKPADLFSNPWMVIIIERGMMKCGGSLITPRYV 77
            |.||......|......|.....||...|::.|.|.:..|..||..:.......|||||::.|||
Mosquito    82 APVFASDSSGPSQNCTPCKCGSVEPINERIVGGIPVEDNSFSWMAALYYDNKFCCGGSLLSDRYV 146

  Fly    78 LTAAHCKSE-TKSQLTVRLGDYDVNQAVDCSSYGCIPRPREINVTRTYVPSHYTNFRKNDIALLR 141
            :|||||.:: .:....|:.|..|.::.:..|    |.|..:..:|..|  :.:.|  .||||||.
Mosquito   147 ITAAHCTTKPDRGLFRVQFGINDRSKPIATS----IERSVKRILTNWY--NAFNN--NNDIALLE 203

  Fly   142 LETTVQYGDNIRSICLLMGD--YTWSSNILKNLVKFNTTGWGRTESRIN-SPVLQQAS---LTHH 200
            |...|...|.:..|||....  |..|..|:        ||||||::... |..|.|..   ||:.
Mosquito   204 LTYPVAISDRVMPICLPQATEMYEGSRGIV--------TGWGRTKAGGGLSGTLMQTEVPILTNR 260

  Fly   201 HLSYC--AQVFGKQLDKSHICVASSTG--STCQGDSGGPLTARVRIGSERRVILFGVVSYGAVHC 261
            .   |  |..:..|:....:|.....|  .:|||||||||  :|.........|.||||:|.. |
Mosquito   261 E---CRRAGYWAFQITNKMLCAGYLEGGKDSCQGDSGGPL--QVLNTKSNHYELVGVVSWGRA-C 319

  Fly   262 FG---PTVYTNVIHFANWIELHTK 282
            ..   |.||..|..:..||..:.|
Mosquito   320 AQKNFPGVYARVSQYLYWINRNIK 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30287NP_726083.1 Tryp_SPc 41..277 CDD:214473 80/249 (32%)
Tryp_SPc 42..280 CDD:238113 81/251 (32%)
AgaP_AGAP004552XP_313850.5 Tryp_SPc 110..338 CDD:214473 80/249 (32%)
Tryp_SPc 111..341 CDD:238113 81/251 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.