DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30287 and CLIPC2

DIOPT Version :9

Sequence 1:NP_726083.1 Gene:CG30287 / 246530 FlyBaseID:FBgn0050287 Length:284 Species:Drosophila melanogaster
Sequence 2:XP_313588.3 Gene:CLIPC2 / 1274460 VectorBaseID:AGAP004317 Length:383 Species:Anopheles gambiae


Alignment Length:271 Identity:86/271 - (31%)
Similarity:129/271 - (47%) Gaps:48/271 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 QCVTARSEPGLYRVINGKPADLFSNPWMVIII---ERGMM--KCGGSLITPRYVLTAAHC-KSET 87
            ||.|.::     .::.|..|.....|.|..:.   |.|.|  :||.:||:.::|:||||| :|:|
Mosquito   122 QCPTDQN-----LIVGGTAARFGEFPHMARLAMPDENGAMVFRCGATLISEQWVMTAAHCLESQT 181

  Fly    88 KSQLTVRLGDYDVNQAVDCSSYGCIPRPREINVTRTYV-PSHYTNFRKNDIALLRLETTVQYGDN 151
               :.||||  ::.:..|  .:|   .|.::.|||... |::......||||||:|...|.:...
Mosquito   182 ---IVVRLG--ELKEGND--EFG---DPVDVQVTRIVKHPNYKPRTVYNDIALLKLARPVTFSMR 236

  Fly   152 IRSICLLMGDYTWSSNILKNLVKFNTTGWGRTES-RINSPVLQQASLTHHHLSYCAQVFGKQ--- 212
            ||..||.     .||.:  :..|....|:|.||: ...|..|.:.||.....:.|:..|.:.   
Mosquito   237 IRPACLY-----GSSTV--DRTKAVAIGFGSTEAYGAASKELLKVSLDVFTTAACSVFFQRNRRV 294

  Fly   213 ---LDKSHICVASSTG--STCQGDSGGPLTARVRIGSERRVI---LFGVVSYGAVHCFG--PTVY 267
               |.:||:|....:|  .||.|||||||    :|.||....   :.|:.|:| :.|..  |.:|
Mosquito   295 PQGLRESHLCAGFLSGGRDTCTGDSGGPL----QISSEDEACVAQIIGITSFG-IGCGSTTPGIY 354

  Fly   268 TNVIHFANWIE 278
            |.|..:.:|||
Mosquito   355 TRVSEYIDWIE 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30287NP_726083.1 Tryp_SPc 41..277 CDD:214473 80/256 (31%)
Tryp_SPc 42..280 CDD:238113 83/258 (32%)
CLIPC2XP_313588.3 Tryp_SPc 130..367 CDD:238113 83/258 (32%)
Tryp_SPc 130..364 CDD:214473 80/255 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.