DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30287 and AgaP_AGAP003686

DIOPT Version :9

Sequence 1:NP_726083.1 Gene:CG30287 / 246530 FlyBaseID:FBgn0050287 Length:284 Species:Drosophila melanogaster
Sequence 2:XP_313469.4 Gene:AgaP_AGAP003686 / 1274361 VectorBaseID:AGAP003686 Length:368 Species:Anopheles gambiae


Alignment Length:272 Identity:87/272 - (31%)
Similarity:119/272 - (43%) Gaps:53/272 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 RSEPGLYRVIN----GKPADLFSNPWMVIII------ERGMMKCGGSLITPRYVLTAAHC-KSET 87
            |:..||...:|    |:.|.||..|||.:|:      .....:|.|::|..||||||||| ..:.
Mosquito   116 RTNCGLPGTVNKIAFGQQARLFQYPWMAMIVYVSNTTGTESSECAGTIINVRYVLTAAHCIDGQM 180

  Fly    88 KSQLTVRLGDYDVNQAVDCSSYGCIPRPREINVTRTYVPSHYTNFRK--NDIALLRLETTVQY-- 148
            :....||:|:||.....||....|....:...|.......::|...:  :||.||||..::.:  
Mosquito   181 ERMRYVRIGEYDTRTDPDCEEDTCAAPIQRYGVEDAIFHPNFTRIVRSGHDIGLLRLNRSIDFSS 245

  Fly   149 GDNIRSICL-----LMG-DYT--WSSNILKNLVKFNTTGWGRTESRINSPVLQQASLTHHHLSYC 205
            || :..:||     ||| |.|  |            .||||.||....||||.||.:.....|  
Mosquito   246 GD-VSPVCLPFTTGLMGFDPTLYW------------ITGWGLTERLEVSPVLLQARIPPVSCS-- 295

  Fly   206 AQVFGKQLDKSHICVASSTGST-CQGDSGGPLTARVRIGSERRVILFGVVSYGAVHCFG----PT 265
                   |....||......:. |:||||||:.|:|. ....|.:.:||:|.|. .| |    |.
Mosquito   296 -------LSSYAICAGFGNATLHCEGDSGGPMKAQVP-EYNFRFVQYGVISAGP-RC-GTQGVPG 350

  Fly   266 VYTNVIHFANWI 277
            :.:.|..|..||
Mosquito   351 ISSRVSFFMQWI 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30287NP_726083.1 Tryp_SPc 41..277 CDD:214473 82/263 (31%)
Tryp_SPc 42..280 CDD:238113 84/264 (32%)
AgaP_AGAP003686XP_313469.4 CLIP 16..75 CDD:288855
Tryp_SPc 131..362 CDD:214473 81/255 (32%)
Tryp_SPc 131..362 CDD:238113 81/255 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BQ4K
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25819
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.