DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30287 and AgaP_AGAP003248

DIOPT Version :9

Sequence 1:NP_726083.1 Gene:CG30287 / 246530 FlyBaseID:FBgn0050287 Length:284 Species:Drosophila melanogaster
Sequence 2:XP_312959.4 Gene:AgaP_AGAP003248 / 1273921 VectorBaseID:AGAP003248 Length:296 Species:Anopheles gambiae


Alignment Length:304 Identity:87/304 - (28%)
Similarity:122/304 - (40%) Gaps:94/304 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 QPHLLDPQCVTARSEPGLYRVINGKPADLFSNPWMVII---IERGMMK--CGGSLITPRYVLTAA 81
            ||    |.|.....|    |:|....|.|...|||.:|   ...|.:.  ||||||..|||:|||
Mosquito    36 QP----PMCGNDAPE----RLITSLVAQLDEAPWMALIEYWKPNGSLSYLCGGSLINERYVVTAA 92

  Fly    82 HCKSETKSQLTV---RLGDYDVNQAVDCSSYGCIPRPREINVTRTYVPSHY---TNFRKNDIALL 140
            ||.:......||   |||::|::.:.||....|...|.::.|.:..|...|   :...:|||||:
Mosquito    93 HCVTSLPQGWTVHRIRLGEWDLSTSEDCDHSRCNDAPIDVAVDKITVHEDYKSPSRNHRNDIALI 157

  Fly   141 RLETTVQYGDNIRSICLLMGDYTWSSNILKNLVKFNTTGWGRTESRINSPVLQQASLTHHHLSYC 205
            ||:..:.|.:.:..|||..                            |.|:..|...|.|.:.:.
Mosquito   158 RLDRQMHYTETVAPICLPQ----------------------------NGPLQTQRYRTMHSVGWI 194

  Fly   206 AQVF----GKQLD-----------------------KSHICVASSTGSTCQGD-----SGGPLTA 238
            .:.|    ||:|.                       .:.:|||.      |.|     :||||..
Mosquito   195 EENFGPIGGKKLQVEQDLVDFQNCSSNYLQASIALADTQLCVAQ------QKDNRIDIAGGPLMQ 253

  Fly   239 RVRIGSERRVILFGVVSYGAVHCFG----PTVYTNVIHFANWIE 278
            |:    .....||||.|:|..: :|    |.|||||:.:.:|||
Mosquito   254 RI----AGHWYLFGVASFGGRN-YGTVELPNVYTNVMEYVDWIE 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30287NP_726083.1 Tryp_SPc 41..277 CDD:214473 79/282 (28%)
Tryp_SPc 42..280 CDD:238113 81/284 (29%)
AgaP_AGAP003248XP_312959.4 Tryp_SPc 53..291 CDD:214473 77/276 (28%)
Tryp_SPc 54..294 CDD:238113 80/278 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.