DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30287 and CLIPD1

DIOPT Version :9

Sequence 1:NP_726083.1 Gene:CG30287 / 246530 FlyBaseID:FBgn0050287 Length:284 Species:Drosophila melanogaster
Sequence 2:XP_312523.4 Gene:CLIPD1 / 1273538 VectorBaseID:AGAP002422 Length:435 Species:Anopheles gambiae


Alignment Length:263 Identity:85/263 - (32%)
Similarity:120/263 - (45%) Gaps:57/263 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 LYRVINGKPADLFSNPWMVIIIERGMMKCGGSLITPRYVLTAAHCKSETK-SQLTVRLGDYDVNQ 102
            |.::..|:|||....||||.::......|||.|||.|:|||||||....| :|..||||:||..|
Mosquito   200 LSKIAGGRPADSNEWPWMVALVSSRASFCGGVLITDRHVLTAAHCVMNLKLTQFVVRLGEYDFKQ 264

  Fly   103 AVDCSSYGCIPRPREINVTRTYVPSHYTNFR---------------KNDIALLRLETTVQYGDNI 152
                           .|.||      |.:||               :||||:|:|.....:...|
Mosquito   265 ---------------FNETR------YRDFRVAEIRAHADFDQISYENDIAMLKLIQPSFFNSYI 308

  Fly   153 RSICLLMGDYTWSSNILKNLVKFNTTGWGRTE--SRINSPVLQQASLTHHHLSYCAQVFGKQLDK 215
            ..||:...|..|:.      .:...|||| |:  ...:||||.:..:.......|.:|:..::..
Mosquito   309 WPICMPPLDDAWTG------YQAVVTGWG-TQFFGGPHSPVLMEVRIPIWSNQECQEVYVNRIYN 366

  Fly   216 SHICVASSTG--STCQGDSGGPLTARVRIGSERRVILFGVVSYGAVHCFG----PTVYTNVIHFA 274
            :.:|.....|  .:|||||||||..::   ..||..:.|:||:| :.| |    |.:||.|..:.
Mosquito   367 TTLCAGEYDGGKDSCQGDSGGPLMIQL---PNRRWAVVGIVSWG-IRC-GEANHPGIYTRVSSYV 426

  Fly   275 NWI 277
            .||
Mosquito   427 RWI 429

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30287NP_726083.1 Tryp_SPc 41..277 CDD:214473 82/259 (32%)
Tryp_SPc 42..280 CDD:238113 84/260 (32%)
CLIPD1XP_312523.4 CLIP 102..147 CDD:197829
Tryp_SPc 202..429 CDD:214473 82/259 (32%)
Tryp_SPc 203..432 CDD:238113 84/260 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.