DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30287 and AgaP_AGAP002432

DIOPT Version :9

Sequence 1:NP_726083.1 Gene:CG30287 / 246530 FlyBaseID:FBgn0050287 Length:284 Species:Drosophila melanogaster
Sequence 2:XP_312513.5 Gene:AgaP_AGAP002432 / 1273529 VectorBaseID:AGAP002432 Length:318 Species:Anopheles gambiae


Alignment Length:281 Identity:82/281 - (29%)
Similarity:125/281 - (44%) Gaps:75/281 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 RVINGKPADLFSNPWMVIII---ERGMMKCGGSLITPRYVLTAAHC------KSETKSQLTVRLG 96
            |::||:.|.....|:.|.::   ..|:..||.|:||.|||||||||      .|...:..|..||
Mosquito    67 RIVNGQEARPGQFPYQVALLGQFNAGVGLCGASIITQRYVLTAAHCVYTGVDASAPVANGTAILG 131

  Fly    97 DYD------VNQAVDCSSYGCIPRPREINVTRTYVPSHYTNFR-KNDIALLRLETTVQYGDNIRS 154
            .::      ..|.:..||.|.|..|            .|..|. :||||::||:..:.|.|.|:.
Mosquito   132 AHNRMIEEPSQQRITFSSSGVIGHP------------GYDLFDVRNDIAVVRLDELIVYTDRIQP 184

  Fly   155 ICL-----------LMGD------YTWSSNILKNLVKFNTTGWGRTESRINSPVLQQASLTHHHL 202
            |.|           |||.      |:.::..|.:::.:           :.:||:..|.      
Mosquito   185 IRLPSRSDTRTFAGLMGTVSGYGIYSTANPALSDVLNY-----------VLNPVMTNAD------ 232

  Fly   203 SYC-AQVFGKQ--LDKSHICVASSTG-STCQGDSGGPLTARVRIGSERRVILFGVVSYG-AVHCF 262
              | |...|.:  ::..:||.:...| :.|..|||||||.: ..|...:|   ||||:| :|.|.
Mosquito   233 --CRAGWSGLEWLIEAQNICQSGDGGRAACNSDSGGPLTVQ-DSGESLQV---GVVSFGSSVGCD 291

  Fly   263 G--PTVYTNVIHFANWIELHT 281
            .  |||:..|.::..|||.::
Mosquito   292 NGVPTVFARVTYYLEWIEANS 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30287NP_726083.1 Tryp_SPc 41..277 CDD:214473 79/275 (29%)
Tryp_SPc 42..280 CDD:238113 81/277 (29%)
AgaP_AGAP002432XP_312513.5 Tryp_SPc 67..308 CDD:214473 79/275 (29%)
Tryp_SPc 68..311 CDD:238113 81/277 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.