DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30287 and CLIPD6

DIOPT Version :9

Sequence 1:NP_726083.1 Gene:CG30287 / 246530 FlyBaseID:FBgn0050287 Length:284 Species:Drosophila melanogaster
Sequence 2:XP_312099.2 Gene:CLIPD6 / 1273147 VectorBaseID:AGAP002813 Length:484 Species:Anopheles gambiae


Alignment Length:282 Identity:98/282 - (34%)
Similarity:138/282 - (48%) Gaps:40/282 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 GQPHLLDPQCVTARSEPGLYRVINGKPADLFSNPWMVIIIERGMM-----KCGGSLITPRYVLTA 80
            |...||.|:.....|.....||:.|.||:|...|||.::..:..:     ||||||||.|:||||
Mosquito   212 GPAELLTPETGCGYSTVQHNRVVGGVPAELNGWPWMALVGYKNTLGEVSFKCGGSLITKRHVLTA 276

  Fly    81 AHCKSETKSQLTVRLGDYDVNQAVDCSSYGCIPRPREINVTRTYVPSHYTNFRKN---DIALLRL 142
            |||.....|  :||||::|.:...:         .:.|:|......||.:..:|:   |:|:|.:
Mosquito   277 AHCIRRDLS--SVRLGEHDTSTDAE---------TKHIDVPVVRYESHPSYDKKDGHTDLAVLYM 330

  Fly   143 ETTVQYGDNIRSICLLMGDYTWSSNILKNLVKFN--TTGWGRT-ESRINSPVLQQASLTHHHLSY 204
            |..||:.|.|:.|||.:.:...|    ||.:.:.  ..||||| |...::.|||:..:.......
Mosquito   331 EFEVQFSDAIKPICLPLSETIRS----KNFIGYTPFVAGWGRTQEGGKSANVLQELQIPIIANDE 391

  Fly   205 C-------AQVFG-KQLDKSHICVASSTG--STCQGDSGGPLTARVRIGSERRVILFGVVSYGAV 259
            |       .:||. ||.|.:.:|.....|  .:|||||||||....|.|:|......|:|||| :
Mosquito   392 CRTLYDKIGKVFSQKQFDNAVMCAGVIEGGKDSCQGDSGGPLMLPQRFGTEFYYYQVGIVSYG-I 455

  Fly   260 HCFG---PTVYTNVIHFANWIE 278
            .|..   |.|||.|..|.:||:
Mosquito   456 GCARAEVPGVYTRVASFVDWIQ 477

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30287NP_726083.1 Tryp_SPc 41..277 CDD:214473 91/259 (35%)
Tryp_SPc 42..280 CDD:238113 92/261 (35%)
CLIPD6XP_312099.2 CLIP 25..80 CDD:288855
CLIP 114..166 CDD:288855
Tryp_SPc 232..476 CDD:214473 91/259 (35%)
Tryp_SPc 233..479 CDD:238113 92/261 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.