DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30287 and AgaP_AGAP010415

DIOPT Version :9

Sequence 1:NP_726083.1 Gene:CG30287 / 246530 FlyBaseID:FBgn0050287 Length:284 Species:Drosophila melanogaster
Sequence 2:XP_311533.3 Gene:AgaP_AGAP010415 / 1272633 VectorBaseID:AGAP010415 Length:304 Species:Anopheles gambiae


Alignment Length:184 Identity:53/184 - (28%)
Similarity:85/184 - (46%) Gaps:35/184 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 PWMVII----IERGMMKCGGSLITPRYVLTAAHCKSETKSQLTVRLGDYDVNQAVDCSSYG---- 110
            ||||.:    ::...:.|.|.|:...|||| .:| .:.:.:::|.|||||.::..||.:..    
Mosquito   137 PWMVTLRHPFVDSEYVPCNGVLLNRNYVLT-TNC-VDLQDEISVTLGDYDTSKTKDCGTIDGREQ 199

  Fly   111 CIPRPREINVTRTYVPSHYTNFRKNDIALLRLETTVQYG--DNIRSICLLMGDYTWSSNILKNLV 173
            |:...:.::|.:.        |||:::.|.||......|  |:|.||||.:...  ....|.|  
Mosquito   200 CVSGVQTVSVGQL--------FRKDNLVLARLTVPAVIGRRDHIESICLPVTPQ--QRERLYN-- 252

  Fly   174 KFNTTGWGRTESRINSPVLQQASLTHHHLSYCAQVF---------GKQLDKSHI 218
            ::..|||  .||..::.:||:|.|....|:.|...|         .||:|...|
Mosquito   253 RYIMTGW--KESGSDARILQRALLEAIDLNKCRAEFQASSYASEASKQIDSKTI 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30287NP_726083.1 Tryp_SPc 41..277 CDD:214473 53/184 (29%)
Tryp_SPc 42..280 CDD:238113 53/184 (29%)
AgaP_AGAP010415XP_311533.3 Tryp_SPc <1..92 CDD:304450
Tryp_SPc 135..>294 CDD:304450 49/172 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.