DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30287 and CLIPA8

DIOPT Version :9

Sequence 1:NP_726083.1 Gene:CG30287 / 246530 FlyBaseID:FBgn0050287 Length:284 Species:Drosophila melanogaster
Sequence 2:XP_311445.2 Gene:CLIPA8 / 1272532 VectorBaseID:AGAP010731 Length:369 Species:Anopheles gambiae


Alignment Length:280 Identity:83/280 - (29%)
Similarity:128/280 - (45%) Gaps:66/280 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 SEPG--LYRVINGKP-ADLFSNPWMVIIIER------------GMMKCGGSLITPRYVLTAAHCK 84
            |.||  :|:|...:. |.....||:|.|:|.            |    ||:||.||:|:||||..
Mosquito   111 SNPGGLIYQVEGNRTYAQYGEFPWVVAILEAFYSSNEQQFTYVG----GGTLIHPRFVVTAAHIF 171

  Fly    85 SETKSQLTVRLGDYDVNQAVDCSSYGCIPRPREINVTRTYV--PSHYTNFRKNDIALLRLETTVQ 147
            ::|:: |....|::|:|:  |.:.|   |: :.|::.||.:  |.:.:....|||||.:|:..|.
Mosquito   172 NKTEN-LVASFGEWDMNR--DENVY---PK-QNIDIDRTIIVHPEYNSVGLLNDIALAQLKQNVV 229

  Fly   148 YGDNIRSICLLMGDYTWSSNILKNLVKFNTTGWG---------RTESRINSPVLQQASLTHHHLS 203
            |..:||.|||......:...:.      .:||||         ....|::.||:.:||       
Mosquito   230 YDKHIRPICLPNPTDRFDDQLC------ISTGWGIEALTSAYANVLKRVDLPVIARAS------- 281

  Fly   204 YCAQVFGK-------QLDKSHICVASSTGS-TCQGDSGGPLTARVRIGSERRVILFGVVSYGAVH 260
             |.::|.:       :|.||.:|.....|: .|.||.|..|......|:   .:|.|:||:| :.
Mosquito   282 -CKKLFAETRLGPFFRLHKSVLCAGGEEGADMCDGDGGSGLACPNESGA---YVLAGIVSWG-LS 341

  Fly   261 CFG---PTVYTNVIHFANWI 277
            |..   |..|.||..|..||
Mosquito   342 CHQQNVPGAYVNVARFVTWI 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30287NP_726083.1 Tryp_SPc 41..277 CDD:214473 77/270 (29%)
Tryp_SPc 42..280 CDD:238113 79/271 (29%)
CLIPA8XP_311445.2 Tryp_SPc 127..364 CDD:238113 78/264 (30%)
Tryp_SPc 127..361 CDD:214473 76/262 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.