DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30287 and AgaP_AGAP010730

DIOPT Version :9

Sequence 1:NP_726083.1 Gene:CG30287 / 246530 FlyBaseID:FBgn0050287 Length:284 Species:Drosophila melanogaster
Sequence 2:XP_311444.4 Gene:AgaP_AGAP010730 / 1272531 VectorBaseID:AGAP010730 Length:256 Species:Anopheles gambiae


Alignment Length:252 Identity:73/252 - (28%)
Similarity:111/252 - (44%) Gaps:43/252 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 PWMVIII-------ERGMMKCGGSLITPRYVLTAAHCKSETKSQLTVRLGDYDVNQAVDCSSYGC 111
            ||:|.|:       ..|...|||:||..|.|:|.|| .::.|:.|..|.|::|::...:.....|
Mosquito     9 PWVVYILALKKQEANSGDFVCGGTLIHSRLVVTTAH-NTDGKTDLVARFGEWDISTTKEPFPQQC 72

  Fly   112 IPRPREINVTRTYV-PSHYTNFRKNDIALLRLETTVQYGDNIRSICL------LMGDYTWSSNIL 169
            :...::|:|..... |.:..|..:||||||.|...|||..:||.|||      .:|....|:   
Mosquito    73 LFPHQDIDVAEVIKHPQYVFNPIQNDIALLVLAENVQYAAHIRPICLPQPTDEFVGQRCVSN--- 134

  Fly   170 KNLVKFNTTGWGRTE-------SRINSPVLQQASLTHHHLSYCAQVFGKQLDKSHICVASSTG-S 226
                     |||:..       .::..||:.:|:.| ..|.|........|.:..:|...... .
Mosquito   135 ---------GWGKERGVYANVMKKLTLPVIGRANCT-RMLRYAGLGPFYTLREGFLCAGGEVAVD 189

  Fly   227 TCQGDSGGPLTARVRIGSERRVILFGVVSYGAVHCFG---PTVYTNVIHFANWIELH 280
            .|:||.|.||..:...|:   .:|.|:||:| :.|.|   |.||..|..:..|:..|
Mosquito   190 MCKGDGGSPLACQTESGT---YVLAGIVSWG-IGCGGFNTPGVYVAVNRYVQWLNEH 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30287NP_726083.1 Tryp_SPc 41..277 CDD:214473 71/247 (29%)
Tryp_SPc 42..280 CDD:238113 72/250 (29%)
AgaP_AGAP010730XP_311444.4 Tryp_SPc 7..242 CDD:238113 72/250 (29%)
Tryp_SPc 7..238 CDD:214473 71/246 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25819
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.