DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30287 and AgaP_AGAP000290

DIOPT Version :9

Sequence 1:NP_726083.1 Gene:CG30287 / 246530 FlyBaseID:FBgn0050287 Length:284 Species:Drosophila melanogaster
Sequence 2:XP_310831.5 Gene:AgaP_AGAP000290 / 1271969 VectorBaseID:AGAP000290 Length:499 Species:Anopheles gambiae


Alignment Length:266 Identity:78/266 - (29%)
Similarity:112/266 - (42%) Gaps:47/266 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 GLYRVINGKPADLFSNPWMVII---IERG--MMKCGGSLITPRYVLTAAHCKSETK---SQLTVR 94
            |:.:.:.| |......||.|.|   |..|  :..|||:|:....|:|||||.|..:   ::..|.
Mosquito   252 GISQAVAG-PVGFSEFPWTVAIHQLIRNGSYVYHCGGALLNQSVVVTAAHCVSNNRLHPNRFVVY 315

  Fly    95 LGDYDVNQAVDCSSYGCIPRPREINVTRTYV-PSHYTNFRKNDIALLRLETTVQYGD---NIRSI 155
            .||:|.....:     .:|. :|..|:|..| |::|:....||:|||..  :..:.|   |:..:
Mosquito   316 AGDWDRRHTQE-----RLPH-QERTVSRVLVHPNYYSGALFNDLALLFF--SEPFNDTVANVEPV 372

  Fly   156 CLLM---GDYTWSSNILKNLVKFNTTGWGRTESRINSPVLQQAS---LTHHH-----LSYCAQVF 209
            ||..   .||....|..       .||||.:.....:..:||.|   |...|     |.....:.
Mosquito   373 CLSSPSGTDYIPPDNCF-------VTGWGGSPKGNRAQSIQQYSKLQLVERHRCETQLQSLPTLG 430

  Fly   210 GK-QLDKSHICVASSTGSTCQGDSGGPLTARVRIGSERRVILFGVVSYGAVHCFG--PTVYTNVI 271
            .| :|.:|.:|.|:.....|||..|.|....    .:.|..|.|:||:| |.|..  |.|.|||.
Mosquito   431 SKFKLHQSFVCAATDGTDVCQGSGGSPYACE----RDGRYYLVGIVSWG-VGCGDGIPAVLTNVT 490

  Fly   272 HFANWI 277
            ....||
Mosquito   491 ELREWI 496

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30287NP_726083.1 Tryp_SPc 41..277 CDD:214473 75/261 (29%)
Tryp_SPc 42..280 CDD:238113 77/262 (29%)
AgaP_AGAP000290XP_310831.5 Tryp_SPc 265..499 CDD:238113 75/252 (30%)
Tryp_SPc 265..496 CDD:214473 73/250 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.