DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30287 and AgaP_AGAP000331

DIOPT Version :9

Sequence 1:NP_726083.1 Gene:CG30287 / 246530 FlyBaseID:FBgn0050287 Length:284 Species:Drosophila melanogaster
Sequence 2:XP_310784.4 Gene:AgaP_AGAP000331 / 1271927 VectorBaseID:AGAP000331 Length:4655 Species:Anopheles gambiae


Alignment Length:190 Identity:41/190 - (21%)
Similarity:59/190 - (31%) Gaps:61/190 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 KCGGSLITPRYVLTAAHC---KSETKSQLTVRLGDYDVNQAVDCSSYG----------------C 111
            |||.|       ||...|   ...|.|.......|.|     :|:.:|                |
Mosquito   303 KCGPS-------LTGGVCYCPAGRTLSPDNRTCADLD-----ECTVWGHCDQLCTNTDGSFSCAC 355

  Fly   112 IPRPREINVTRTYVP--SHYTNFRKNDIALLRLETTVQYGDNIRSICLLMGDYTWSSNILKNLVK 174
            ......:..||...|  |....|...|.|:||:..   :|.:.|.|....|....|.:..|||:.
Mosquito   356 ATGYTLMEKTRCVAPTASSLELFFAYDRAILRMSA---HGQDSRIIANATGASGLSYHYAKNLLY 417

  Fly   175 FNTTGWGRTESR-INSPVLQQASLTHHHLS-------------------YCAQVFGKQLD 214
                 |...::| :.|.||.......|..:                   |.|.:.|:::|
Mosquito   418 -----WSDIKTRKVQSQVLVDGGFGGHDFTLPGTWAPVAIAIDWVGDKLYVADLVGQKVD 472

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30287NP_726083.1 Tryp_SPc 41..277 CDD:214473 41/190 (22%)
Tryp_SPc 42..280 CDD:238113 41/190 (22%)
AgaP_AGAP000331XP_310784.4 LDLa 35..68 CDD:238060
LDLa 75..114 CDD:238060
LDLa 170..205 CDD:238060
LDLa 210..244 CDD:238060
LDLa 249..287 CDD:238060
vWFA <325..366 CDD:294047 5/45 (11%)
NHL 449..>556 CDD:302697 4/24 (17%)
NHL repeat 449..486 CDD:271320 4/24 (17%)
NHL repeat 492..530 CDD:271320
FXa_inhibition 639..681 CDD:291342
NHL <723..881 CDD:302697
NHL repeat 723..766 CDD:271320
NHL repeat 767..803 CDD:271320
LY 798..840 CDD:214531
NHL repeat 805..845 CDD:271320
LY 849..884 CDD:214531
NHL repeat 852..881 CDD:271320
FXa_inhibition 957..1011 CDD:291342
LDLa 1030..1056 CDD:197566
LDLa 1065..1099 CDD:238060
LDLa 1103..1135 CDD:197566
LDLa 1144..1179 CDD:238060
LDLa 1184..1219 CDD:238060
LDLa 1232..1263 CDD:238060
LDLa 1267..1299 CDD:197566
FXa_inhibition 1398..1429 CDD:291342
LY 1501..1541 CDD:214531
LY 1543..1587 CDD:214531
Ldl_recept_b 1566..1604 CDD:278487
LY 1588..1630 CDD:214531
Ldl_recept_b 1889..1931 CDD:278487
FXa_inhibition 2027..>2055 CDD:291342
LY 2135..2181 CDD:214531
LY 2182..2224 CDD:214531
LY 2228..2268 CDD:214531
NHL <2464..2609 CDD:302697
NHL repeat 2465..2500 CDD:271320
NHL repeat 2503..2543 CDD:271320
LY 2543..2585 CDD:214531
NHL repeat 2552..2584 CDD:271320
LDLa 2739..2773 CDD:238060
LDLa 2778..2813 CDD:238060
LDLa 2821..2854 CDD:197566
LDLa 2906..2938 CDD:197566
LDLa 2948..2987 CDD:197566
LDLa 3000..3035 CDD:238060
LDLa 3042..3076 CDD:238060
LDLa 3082..3114 CDD:197566
vWFA <3118..3158 CDD:294047
vWFA <3156..3196 CDD:294047
LY 3281..3321 CDD:214531
Ldl_recept_b 3341..3383 CDD:278487
LY 3372..3409 CDD:214531
LY 3409..3451 CDD:214531
FXa_inhibition 3480..3532 CDD:291342
LDLa 3536..3569 CDD:238060
LDLa 3578..3612 CDD:238060
LDLa 3616..3648 CDD:197566
LDLa 3660..3690 CDD:238060
LDLa 3700..3734 CDD:197566
LDLa 3745..3774 CDD:197566
LDLa 3786..3820 CDD:238060
LDLa 3825..3859 CDD:238060
LDLa 3869..3900 CDD:197566
LDLa 3916..3944 CDD:238060
LDLa 3959..3990 CDD:238060
vWFA <4030..4068 CDD:294047
NHL 4148..>4291 CDD:302697
NHL repeat 4163..4208 CDD:271320
NHL repeat 4212..4248 CDD:271320
Ldl_recept_b 4222..4262 CDD:278487
NHL repeat 4253..4291 CDD:271320
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.