DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30287 and CLIPC5

DIOPT Version :9

Sequence 1:NP_726083.1 Gene:CG30287 / 246530 FlyBaseID:FBgn0050287 Length:284 Species:Drosophila melanogaster
Sequence 2:XP_310507.4 Gene:CLIPC5 / 1271651 VectorBaseID:AGAP000571 Length:374 Species:Anopheles gambiae


Alignment Length:281 Identity:74/281 - (26%)
Similarity:120/281 - (42%) Gaps:51/281 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 SEPGL-YRVINGKPADLFSNPWMVIIIERG-------------MMKCGGSLITPRYVLTAAHC-K 84
            ::|.| |.:|.|..|.....|::..:..|.             :..||.||||.|::|||||| :
Mosquito   102 TQPQLAYHIIAGSKAQEADVPFIAALGYRPSPADDGPPTGAGYLWACGSSLITVRFLLTAAHCIR 166

  Fly    85 SETKSQLTVRLGDYDVNQAVDCSSYGCIPRPREI---NVTRTYVPSHYTNFRKNDIALLRLETTV 146
            :.....:..|:|..|:...         |.|.::   ::....|...|.| :.:|||||.:....
Mosquito   167 TPHGMPVVARMGTIDLLSP---------PVPADVQDRSIKNIIVHPQYRN-KYDDIALLEVTDPF 221

  Fly   147 QYGDNIRSICLLMGDYTWSSNILKNLVKFNTTGWGRTESRINSPVLQQASLTHHHLSYCAQVFG- 210
            |....::.|||......:..:::     ....|||:||...:|..|.:|:|:...::.|.:.:. 
Mosquito   222 QMDVVLQPICLRTDTDEFGPDVV-----LQVAGWGQTEESTSSAGLLRANLSTVPVAECDRTYAG 281

  Fly   211 ------KQLDKSHICVASST--------GSTCQGDSGGPLTARVRIGSERRVILFGVVSYGAVHC 261
                  |.:..|..|.....        ..:|:|||||||..........:..|.||.|:| :.|
Mosquito   282 AMLAKVKSIRPSQYCARGFRAPGEDNWYSDSCEGDSGGPLYHVEGEEGSSKYYLVGVTSFG-LGC 345

  Fly   262 FG--PTVYTNVIHFANWIELH 280
            ..  |:|||.|.::.:|||.|
Mosquito   346 GSSTPSVYTRVAYYLDWIESH 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30287NP_726083.1 Tryp_SPc 41..277 CDD:214473 67/269 (25%)
Tryp_SPc 42..280 CDD:238113 70/271 (26%)
CLIPC5XP_310507.4 CLIP 30..77 CDD:197829
Tryp_SPc 109..363 CDD:214473 67/269 (25%)
Tryp_SPc 110..366 CDD:238113 70/271 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.