DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30287 and CLIPC10

DIOPT Version :9

Sequence 1:NP_726083.1 Gene:CG30287 / 246530 FlyBaseID:FBgn0050287 Length:284 Species:Drosophila melanogaster
Sequence 2:XP_310506.4 Gene:CLIPC10 / 1271650 VectorBaseID:AGAP000572 Length:380 Species:Anopheles gambiae


Alignment Length:283 Identity:80/283 - (28%)
Similarity:118/283 - (41%) Gaps:51/283 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 QCVTARSEPGLY-RVINGKPADLFSNPWMVII-------IERG---MMKCGGSLITPRYVLTAAH 82
            ||....:..||. .:.||..|.....|:|..:       .|.|   :.:||.|||:.|::|||||
Mosquito   109 QCEQFPNGTGLADHIFNGVAAQFGEFPYMAALGYGAPNGTEAGLPSLFRCGASLISSRFLLTAAH 173

  Fly    83 CKSETKSQLTVRLGDYDVNQAVDCSSYGCIPRPREINVTR-TYVPSHYTNFRKNDIALLRLETTV 146
            |..|  ..:..|||..::..|      ..:..|.:|.:.: |..|.::....:||||||.|...|
Mosquito   174 CLRE--RPVFARLGVLELQPA------RTVDEPLDIAIRQATPHPDYHAVTYQNDIALLELAEPV 230

  Fly   147 QYGD--NIRSICLLMGDYT-WSSNILKNLV--KFNTTGWGRTESRINSPV--LQQASLTHHHLSY 204
            . ||  .:..:||    || .:...|:.|.  ..:..|||..:.....|.  |.:|:::......
Mosquito   231 T-GDWPFVEPVCL----YTNATGGGLEALAGQPLSVQGWGTQQPGDTEPAARLMKANVSLVERDA 290

  Fly   205 CAQVFGKQ------LDKSHICVA------SSTGSTCQGDSGGPLTARVRIGSERRVILFGVVSYG 257
            ||....:.      |....:|..      .:...||.|||||||...|    :.|..|.|:.|.|
Mosquito   291 CAASIPRTRRNPTGLHPGQLCALGRNEQNETVADTCPGDSGGPLALNV----DGRHYLVGITSSG 351

  Fly   258 AVHCFGPT--VYTNVIHFANWIE 278
             ..|..|.  :||.|..:.:|:|
Mosquito   352 -YSCGSPIPGIYTEVARYLDWVE 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30287NP_726083.1 Tryp_SPc 41..277 CDD:214473 74/267 (28%)
Tryp_SPc 42..280 CDD:238113 76/269 (28%)
CLIPC10XP_310506.4 CLIP 45..89 CDD:197829
Tryp_SPc 122..372 CDD:214473 74/267 (28%)
Tryp_SPc 123..375 CDD:238113 76/269 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.