DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30287 and AgaP_AGAP006707

DIOPT Version :9

Sequence 1:NP_726083.1 Gene:CG30287 / 246530 FlyBaseID:FBgn0050287 Length:284 Species:Drosophila melanogaster
Sequence 2:XP_309036.1 Gene:AgaP_AGAP006707 / 1270350 VectorBaseID:AGAP006707 Length:255 Species:Anopheles gambiae


Alignment Length:260 Identity:77/260 - (29%)
Similarity:122/260 - (46%) Gaps:40/260 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 VTARSEPGL-----YRVINGKPADLFSNPWMVII-IERGMMKCGGSLITPRYVLTAAHC-KSETK 88
            |:|...|.|     |||:.|:.|...|.|:.|.: |......|||||:..|:||||||| .....
Mosquito    15 VSAAKLPKLVLDDGYRVVGGEVAKNGSAPYQVSLQIPGHGHNCGGSLLNSRWVLTAAHCIVGHEP 79

  Fly    89 SQLTVRLGDYDVNQAVDCSSYGCIPRPREINVTRTYVPSHYTNFRKNDIALLRLETTVQYGDNIR 153
            :.:.|.:|...:.:.      |.:.:|.:: ....|....:    :|||.|:||:..||:.:.::
Mosquito    80 TNIQVLVGTNSLKEG------GQLYKPDKL-FHHNYASPEF----RNDIGLIRLKEEVQFSEIVQ 133

  Fly   154 SICLLMGDYTWSSNILKNLVKFNTTGWGRTESRINSPVLQQA----SLTHHHLSYCAQVFGKQLD 214
            ||       .:|..::...|....||||||.:..:.|.|.|:    :||:.... ...::.:.:|
Mosquito   134 SI-------EYSEQVVPANVTVRLTGWGRTSAGGSVPTLLQSLNVVTLTNEDCK-AKSLYPEHVD 190

  Fly   215 KSHICVASSTG-STCQGDSGGPLTARVRIGSERRVILFGVVSYGAVHCFG-PTVYTNVIHFANWI 277
            ..|:|..|.:| ..|.|||||||....:        |.|||::|.....| |..:..|.::.:||
Mosquito   191 VGHLCTLSRSGEGACNGDSGGPLVYEGK--------LVGVVNFGVPCGLGYPDGFARVSYYHDWI 247

  Fly   278  277
            Mosquito   248  247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30287NP_726083.1 Tryp_SPc 41..277 CDD:214473 70/243 (29%)
Tryp_SPc 42..280 CDD:238113 71/244 (29%)
AgaP_AGAP006707XP_309036.1 Tryp_SPc 30..247 CDD:214473 70/243 (29%)
Tryp_SPc 31..250 CDD:238113 71/244 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.