DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30287 and CLIPA10

DIOPT Version :9

Sequence 1:NP_726083.1 Gene:CG30287 / 246530 FlyBaseID:FBgn0050287 Length:284 Species:Drosophila melanogaster
Sequence 2:XP_308802.3 Gene:CLIPA10 / 1270130 VectorBaseID:AGAP006954 Length:1130 Species:Anopheles gambiae


Alignment Length:286 Identity:83/286 - (29%)
Similarity:119/286 - (41%) Gaps:78/286 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 DPQCVTARSEPGLYRVINGKPADLFSNPWMVIIIER----GMMKCGGSLITPRYVLTAAHC-KSE 86
            :|..|...||.|.|             ||.|.|:::    .:..|||:||...|::||||| |:.
Mosquito   881 NPVYVDGDSEFGEY-------------PWQVAILKKDPKESVYVCGGTLIDNLYIITAAHCVKTY 932

  Fly    87 TKSQLTVRLGDYDVNQAVDCSSYGCIPRPREINVTRTYVPSHYTNFRKNDIALLRLETTVQY--G 149
            ....|.||||::|||..|:...|    ..|:|...:.: |.:|.....||:|:|:::..|..  .
Mosquito   933 NGFDLRVRLGEWDVNHDVEFYPY----IERDIISVQVH-PEYYAGTLDNDLAILKMDRPVDLTSA 992

  Fly   150 DNIRSICL------LMGDYTWSSNILKNLVKFNTTGWGRTE-----------SRINSPVLQ---- 193
            .:|...||      ..|...|            |||||:..           ..::.|::.    
Mosquito   993 PHIAPACLPDKHTDFSGQRCW------------TTGWGKDAFGDYGKYQNILKEVDVPIVNHYQC 1045

  Fly   194 QASLTHHHLSYCAQVFGKQLDKSHICVASSTG-STCQGDSGGPLTARVRIGSERRVI--LFGVVS 255
            |..|....|.|.     ..|::..||.....| ..|:||.||||..      ||..:  :.||||
Mosquito  1046 QNQLRQTRLGYT-----YNLNQGFICAGGEEGKDACKGDGGGPLVC------ERNGVWQVVGVVS 1099

  Fly   256 YGAVHCFG----PTVYTNVIHFANWI 277
            :| :.| |    |.||..|.|:.:||
Mosquito  1100 WG-IGC-GQANVPGVYVKVAHYLDWI 1123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30287NP_726083.1 Tryp_SPc 41..277 CDD:214473 75/270 (28%)
Tryp_SPc 42..280 CDD:238113 77/271 (28%)
CLIPA10XP_308802.3 Tryp_SPc 888..1126 CDD:238113 81/279 (29%)
Tryp_SPc 888..1123 CDD:214473 79/277 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.