DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30287 and AgaP_AGAP010635

DIOPT Version :9

Sequence 1:NP_726083.1 Gene:CG30287 / 246530 FlyBaseID:FBgn0050287 Length:284 Species:Drosophila melanogaster
Sequence 2:XP_307830.4 Gene:AgaP_AGAP010635 / 1269219 VectorBaseID:AGAP010635 Length:569 Species:Anopheles gambiae


Alignment Length:238 Identity:70/238 - (29%)
Similarity:110/238 - (46%) Gaps:33/238 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 PWMVIIIER---GMMKCGGSLITPRYVLTAAHCKSETKSQLTVRLGDYDVNQAVDCSS-YG---C 111
            ||||.:..:   ..:.|.|.|:...|||| |.| .:.:.::|..|||||.::..||.. ||   |
Mosquito   345 PWMVALQAKTTTEYVPCNGVLLNRNYVLT-AEC-YDLQYEITATLGDYDTSRTKDCGKVYGNMQC 407

  Fly   112 IPRPREINVTRTYVPSHYTNFRKNDIALLRLETTVQYG--DNIRSICLLMGDYTWSSNI-LKNLV 173
            :...:.::|::.        .||:|:.|:||......|  .||.:|||   ..|....| |.|  
Mosquito   408 LSAVQTVSVSQF--------IRKDDLVLVRLSDPADIGRRQNIEAICL---PVTPEQRIRLYN-- 459

  Fly   174 KFNTTGWGRTESRINSPVLQQASLTHHHLSYCAQVFGKQLDKSHICVAS----STGSTCQGDSGG 234
            ::..|||  .||..::.:||:|.|....|:.|...|..::|...|||.:    :....|...:.|
Mosquito   460 RYIMTGW--KESGSDATILQRALLEAIDLNKCRAKFKGRIDSKTICVWNLEDPNRSVACNDYTPG 522

  Fly   235 PLTARVRIGSERRVILFGVVSYGAVHCFGPTVYTNVIHFANWI 277
            .....:...| :|.:|:||:.| ..:|..|..|..:..:..||
Mosquito   523 SALQAIDQKS-KRYLLYGVLRY-ISYCSVPEQYIAISEYLLWI 563

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30287NP_726083.1 Tryp_SPc 41..277 CDD:214473 68/236 (29%)
Tryp_SPc 42..280 CDD:238113 70/238 (29%)
AgaP_AGAP010635XP_307830.4 Tryp_SPc 50..300 CDD:238113
Tryp_SPc 50..297 CDD:214473
Tryp_SPc 342..563 CDD:214473 68/236 (29%)
Tryp_SPc 342..563 CDD:304450 68/236 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.