DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30287 and CLIPA3

DIOPT Version :9

Sequence 1:NP_726083.1 Gene:CG30287 / 246530 FlyBaseID:FBgn0050287 Length:284 Species:Drosophila melanogaster
Sequence 2:XP_024667072.1 Gene:CLIPA3 / 1268922 VectorBaseID:AGAP012591 Length:422 Species:Anopheles gambiae


Alignment Length:295 Identity:84/295 - (28%)
Similarity:121/295 - (41%) Gaps:77/295 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 LDPQCVTARSEPGL-YRVINGKPADLFSN-------PWMVIIIERGMMKCG-GSLITPRYVLTAA 81
            |:..|:....:.|: |..|...|| :.:|       ||.|:::..|.:..| |:||...:|||||
Mosquito   155 LERCCLAGSYQCGMQYPPIANSPA-VTANQAAYGEYPWQVVLLGPGDVYVGSGALIDNLHVLTAA 218

  Fly    82 HCKSETKS---QLTVRLGDYDVNQAVDCSSYGCIPRP-REINVTRTYVPSHYT--NFRKNDIALL 140
            |..|:..|   .|.||||::|.....:       |.| :|..|.|.:|...:|  |.| ||||:|
Mosquito   219 HKISDYTSGTRALKVRLGEWDAASTTE-------PLPVQEFTVARYFVHPSFTAANLR-NDIAIL 275

  Fly   141 RLETTVQYG--DNIRSICL----LMGDYTWSSNILKNLVKFNTTGWGRTE----------SRINS 189
            ||..||..|  ..|.:.||    .:|...|.|            |||:.:          ..::.
Mosquito   276 RLSGTVALGTTPTIATACLPVTSFVGSRCWVS------------GWGKNDFVSGAFQSIPKEVDV 328

  Fly   190 PVLQQASLTHHHLSYCAQVFGKQ-------LD-KSHICVASSTG-STCQGDSGGPLTARVRIGSE 245
            |::..|:        |.......       || .|.:|.....| ..|.||.|.||...:    .
Mosquito   329 PIVNSAN--------CQTALRTTRLGGNFVLDTTSFLCAGGELGKDACTGDGGSPLVCAL----N 381

  Fly   246 RRVILFGVVSYGAVHCFG---PTVYTNVIHFANWI 277
            .|..:.|:|::| :.|..   |.||.||..:..||
Mosquito   382 NRWYVVGLVAWG-IGCGANGIPGVYVNVASYITWI 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30287NP_726083.1 Tryp_SPc 41..277 CDD:214473 78/277 (28%)
Tryp_SPc 42..280 CDD:238113 80/278 (29%)
CLIPA3XP_024667072.1 Tryp_SPc 182..418 CDD:238113 77/267 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.