DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30287 and f7

DIOPT Version :9

Sequence 1:NP_726083.1 Gene:CG30287 / 246530 FlyBaseID:FBgn0050287 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_571894.2 Gene:f7 / 114423 ZFINID:ZDB-GENE-010814-1 Length:433 Species:Danio rerio


Alignment Length:254 Identity:75/254 - (29%)
Similarity:118/254 - (46%) Gaps:33/254 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 RVINGKPADLFSNPWMVIII--ERGMMKCGGSLITPRYVLTAAHCKSETKSQ-LTVRLGDYDVNQ 102
            |::.|........||.|::.  |:|.  |||.:..|.::||||||..:.|.: |.:..|::|:. 
Zfish   195 RIVGGSECPKGHCPWQVLLKYGEKGF--CGGVIYKPTWILTAAHCLEKLKVKFLRIVAGEHDLE- 256

  Fly   103 AVDCSSYGCIPRPREINVTRTYVPSHYTNFRKNDIALLRLETTVQYGDNIRSICLLMGDYT---- 163
             ||..:...|    :::...|: |::.:....:|||||||.|.:.|......:||.:.:..    
Zfish   257 -VDEGTEQLI----QVDQMFTH-PAYVSETADSDIALLRLRTPIVYSVYAVPVCLPLREMAEREL 315

  Fly   164 WSSNILKNLVKFNTTGWG-RTESRINSPVLQQASLTHHHLSYCAQVFGKQLDKSHICVASSTG-- 225
            |:      :.|...:||| |:|....|.:|::..:.......|.||....|..:..|.....|  
Zfish   316 WA------VSKHTVSGWGKRSEDGPTSRLLRRLLVPRIRTQECVQVSNLTLTSNMFCAGYIEGRQ 374

  Fly   226 STCQGDSGGPLTARVRIGSERRVILFGVVSYGAVHCFGP---TVYTNVIHFANWIELHT 281
            .:|:|||||||..|.|    ....|.|:||:|. .|..|   .:||.|.::..||...|
Zfish   375 DSCKGDSGGPLVTRYR----DTAFLLGIVSWGK-GCARPGSYGIYTRVSNYLQWIRQTT 428

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30287NP_726083.1 Tryp_SPc 41..277 CDD:214473 72/248 (29%)
Tryp_SPc 42..280 CDD:238113 73/250 (29%)
f7NP_571894.2 GLA 19..82 CDD:214503
EGF_CA 86..121 CDD:238011
FXa_inhibition 131..166 CDD:291342
Tryp_SPc 195..424 CDD:214473 72/248 (29%)
Tryp_SPc 196..427 CDD:238113 73/250 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.