DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30287 and AgaP_AGAP013487

DIOPT Version :9

Sequence 1:NP_726083.1 Gene:CG30287 / 246530 FlyBaseID:FBgn0050287 Length:284 Species:Drosophila melanogaster
Sequence 2:XP_003436426.1 Gene:AgaP_AGAP013487 / 11176153 VectorBaseID:AGAP013487 Length:308 Species:Anopheles gambiae


Alignment Length:310 Identity:103/310 - (33%)
Similarity:145/310 - (46%) Gaps:52/310 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 GAGAVQLLLLIALVF-----LKVQGQPHLLD-PQCVTARSEPGLYRVINGKPADLFSNPWMVIII 60
            ||....:||.|..||     ...|....|.: |.|.....:    ||::|:...:...||..:| 
Mosquito    14 GAPLFFVLLWIGHVFGLEPVSSTQNTSSLPESPHCGIQLGD----RVLSGQSTQIDEFPWTALI- 73

  Fly    61 ERGMMK--------CGGSLITPRYVLTAAHC-KS---ETKSQLTVRLGDYDVNQAVDCSSYGCIP 113
              ...|        ||||||..||::||||| ||   :.|.| .||||::|:..|.||.:..|..
Mosquito    74 --EFQKPDGSFGFHCGGSLINDRYIVTAAHCIKSIPRDWKVQ-RVRLGEWDLTSANDCQNEFCSD 135

  Fly   114 RPREINVTRTYVPSHYTNFRK---NDIALLRLETTVQYGDNIRSICLLMGDYTWSSNILKN---- 171
            .|.::::.:..|.:.|....|   |||||:|....|.|...:|.|||.:      |:.|:|    
Mosquito   136 APIDLDIEQIVVHTGYDTKDKSNANDIALIRFTRPVNYSQTVRPICLPL------SSSLRNRSHD 194

  Fly   172 -LVKFNTTGWGRTESRINSPVLQQASLTHHHLSYCAQVF---GKQLDKSHICVAS-STGSTCQGD 231
             |:.:. .||.:|.|...|....:..:....|..||.::   |..|.::|:|... .:..||.|:
Mosquito   195 GLISYE-VGWRKTNSATASEKKLKVEVEIKSLQECAPIYERNGILLKQTHMCAGGVRSKDTCSGN 258

  Fly   232 SGGPLTARVRIGSERRVILFGVVSYGAVHC--FG-PTVYTNVIHFANWIE 278
            ||||| .|...||   ..|.||.|:|...|  || |.|||||..:.:||:
Mosquito   259 SGGPL-MRQMTGS---WYLIGVNSFGPRKCGTFGVPDVYTNVAEYVDWIK 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30287NP_726083.1 Tryp_SPc 41..277 CDD:214473 90/262 (34%)
Tryp_SPc 42..280 CDD:238113 91/264 (34%)
AgaP_AGAP013487XP_003436426.1 Tryp_SPc 55..303 CDD:214473 90/262 (34%)
Tryp_SPc 59..306 CDD:238113 90/261 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.