DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30287 and CLIPB9

DIOPT Version :9

Sequence 1:NP_726083.1 Gene:CG30287 / 246530 FlyBaseID:FBgn0050287 Length:284 Species:Drosophila melanogaster
Sequence 2:XP_003436374.1 Gene:CLIPB9 / 11175774 VectorBaseID:AGAP013442 Length:401 Species:Anopheles gambiae


Alignment Length:267 Identity:83/267 - (31%)
Similarity:128/267 - (47%) Gaps:36/267 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 RVINGKPADLFSNPWMVII---IERGMMK--CGGSLITPRYVLTAAHC------KSETKSQLTVR 94
            |:..|:.||:...||:.::   ..:|..|  ||||||..|||||||||      :.|.| .::||
Mosquito   147 RIYGGQNADIDEFPWLALLQYENRKGERKYSCGGSLINRRYVLTAAHCVIGEVERKEGK-LVSVR 210

  Fly    95 LGDYDVNQAVDCSSYG----CIPRPREINVTRTYV-PSHYTNFRKNDIALLRLETTVQYGDNIRS 154
            ||:|:....:||.:..    |...|.:..:....| |.:......:|||||||..:::|...::.
Mosquito   211 LGEYNTKTEIDCVTEEQEEICADPPIDAGIESVIVHPGYQDMAHADDIALLRLAQSIEYTSFVQP 275

  Fly   155 ICLLMGDYTWSSNILKNLVKFNTTGWGRTESRINSPVLQQASLTHHHLSYCAQVF---GKQLDKS 216
            :||.:.|:..|.....|.|    ||:|||.....|.|.|:..:..:..:.|.:.:   ...:..:
Mosquito   276 VCLPLTDFRASKTGEVNFV----TGFGRTLQESRSAVKQKLGIKVYDHARCQEKYATKNSSITTN 336

  Fly   217 HICVASS-TGSTCQGDSGGPLTARVRIGSERRVILFGVVSYGAVHCFG----PTVYTNVIHFANW 276
            .:|.... ...:|.|||||||....::.     .|.|:||||. .| |    |.|||:|..:..|
Mosquito   337 QLCAGGEYAKDSCHGDSGGPLMKLQKVW-----YLEGIVSYGN-RC-GLEDWPGVYTHVPAYMAW 394

  Fly   277 IELHTKK 283
            :..:.|:
Mosquito   395 VRSNIKE 401

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30287NP_726083.1 Tryp_SPc 41..277 CDD:214473 81/259 (31%)
Tryp_SPc 42..280 CDD:238113 81/261 (31%)
CLIPB9XP_003436374.1 CLIP 31..85 CDD:288855
Tryp_SPc 147..395 CDD:214473 81/259 (31%)
Tryp_SPc 148..398 CDD:238113 81/261 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.