DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30287 and KLK11

DIOPT Version :9

Sequence 1:NP_726083.1 Gene:CG30287 / 246530 FlyBaseID:FBgn0050287 Length:284 Species:Drosophila melanogaster
Sequence 2:XP_011524671.1 Gene:KLK11 / 11012 HGNCID:6359 Length:307 Species:Homo sapiens


Alignment Length:314 Identity:82/314 - (26%)
Similarity:125/314 - (39%) Gaps:83/314 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLLIALVFLKVQGQPHLLDPQCVTARSEPGLYRVINGKPADLFSNPWMVIIIERGMMKCGGSLIT 73
            |:|:||....|.|:.                 |:|.|......|.||...:.|:..:.||.:||.
Human    38 LILLALATGLVGGET-----------------RIIKGFECKPHSQPWQAALFEKTRLLCGATLIA 85

  Fly    74 PRYVLTAAHC-------KSETK---------------SQLTVRLGDYDVNQAVDCSSYGCIPRPR 116
            ||::||||||       .|.|.               |:..|.||.:::.:...|..        
Human    86 PRWLLTAAHCLKPWVSLTSPTHVSPDLSSSNYCLSHLSRYIVHLGQHNLQKEEGCEQ-------- 142

  Fly   117 EINVTRTYVPSH----YTNF-----RKNDIALLRLETTVQYGDNIRSICLLMGDYTWSSNILKNL 172
                |||...|.    :.|.     .:|||.|:::.:.|.....:|.:.|.....|..::.|   
Human   143 ----TRTATESFPHPGFNNSLPNKDHRNDIMLVKMASPVSITWAVRPLTLSSRCVTAGTSCL--- 200

  Fly   173 VKFNTTGWGRTES-RINSP-VLQQASLTHHHLSYCAQVFGKQLDKSHICVASSTG--STCQGDSG 233
                .:|||.|.| ::..| .|:.|::|......|...:...:..:.:|.:...|  .:||||||
Human   201 ----ISGWGSTSSPQLRLPHTLRCANITIIEHQKCENAYPGNITDTMVCASVQEGGKDSCQGDSG 261

  Fly   234 GPLTARVRIGSERRVILFGVVSYGAVHCF---GPTVYTNVIHFANWIELHTKKN 284
            |||.....        |.|::|:|...|.   .|.|||.|..:.:||: .|.||
Human   262 GPLVCNQS--------LQGIISWGQDPCAITRKPGVYTKVCKYVDWIQ-ETMKN 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30287NP_726083.1 Tryp_SPc 41..277 CDD:214473 71/273 (26%)
Tryp_SPc 42..280 CDD:238113 72/275 (26%)
KLK11XP_011524671.1 Tryp_SPc 53..300 CDD:214473 71/273 (26%)
Tryp_SPc 54..303 CDD:238113 72/276 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.