DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30287 and F11

DIOPT Version :9

Sequence 1:NP_726083.1 Gene:CG30287 / 246530 FlyBaseID:FBgn0050287 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_082342.1 Gene:F11 / 109821 MGIID:99481 Length:624 Species:Mus musculus


Alignment Length:277 Identity:91/277 - (32%)
Similarity:122/277 - (44%) Gaps:62/277 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 LDPQCVTARSEPGLYRVINGKPADLFSNPWMVII-IERGMMKCGGSLITPRYVLTAAHCKS--ET 87
            :|..| |.:..|   ||:.|..:.....||.|.: |.:|.: ||||:|..:::||||||.|  ||
Mouse   378 MDNVC-TTKINP---RVVGGAASVHGEWPWQVTLHISQGHL-CGGSIIGNQWILTAAHCFSGIET 437

  Fly    88 KSQLTVRLGDYDVNQAVDCSSYGCIPRPREIN-------VTRTYVPSHYTNFRKN-DIALLRLET 144
            ..:|.|               ||.|....|||       |....:...||..... |||||:||:
Mouse   438 PKKLRV---------------YGGIVNQSEINEGTAFFRVQEMIIHDQYTTAESGYDIALLKLES 487

  Fly   145 TVQYGDNIRSICL-LMGDYTWSSNILKNLVKFN--TTGWGRTESR--INSPVLQQASLTHHHLSY 204
            .:.|.|..|.||| ..||        :|.|...  .||||.|..|  :.| .||:|.:.......
Mouse   488 AMNYTDFQRPICLPSKGD--------RNAVHTECWVTGWGYTALRGEVQS-TLQKAKVPLVSNEE 543

  Fly   205 CAQVFGK-QLDKSHICVASSTG--STCQGDSGGPLTARVRIGSERRVILFGVVSYGAVHCFG--- 263
            |...:.: ::....||.....|  .||:|||||||:.:.. |...   |.|:.|:|.    |   
Mouse   544 CQTRYRRHKITNKMICAGYKEGGKDTCKGDSGGPLSCKYN-GVWH---LVGITSWGE----GCGQ 600

  Fly   264 ---PTVYTNVIHFANWI 277
               |.|||||..:.:||
Mouse   601 KERPGVYTNVAKYVDWI 617

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30287NP_726083.1 Tryp_SPc 41..277 CDD:214473 85/260 (33%)
Tryp_SPc 42..280 CDD:238113 86/261 (33%)
F11NP_082342.1 APPLE 20..103 CDD:128519
APPLE 110..193 CDD:128519
APPLE 200..283 CDD:128519
APPLE 291..376 CDD:128519
Tryp_SPc 389..617 CDD:214473 85/260 (33%)
Tryp_SPc 390..617 CDD:238113 84/259 (32%)
Heparin-binding. /evidence=ECO:0000250 547..550 0/2 (0%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.