DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30287 and si:dkey-32n7.7

DIOPT Version :9

Sequence 1:NP_726083.1 Gene:CG30287 / 246530 FlyBaseID:FBgn0050287 Length:284 Species:Drosophila melanogaster
Sequence 2:XP_021335883.1 Gene:si:dkey-32n7.7 / 108191692 ZFINID:ZDB-GENE-121214-179 Length:609 Species:Danio rerio


Alignment Length:254 Identity:70/254 - (27%)
Similarity:109/254 - (42%) Gaps:36/254 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 INGKPADLFSNPWMVIIIERGMMKCGGSLITPRYVLTAAHCKSETKS--QLTVRLGDYDVNQAVD 105
            :.|:.:.....||...:.......||||||...:||:||||.:..::  .|||.||....|:   
Zfish   309 VGGQNSSAVHWPWQASLYWYSGQTCGGSLINKEWVLSAAHCFNGQRNGFYLTVILGPKTQNK--- 370

  Fly   106 CSSYGCIPRPREINVTRTYVPSHYTNFRKNDIALLRLETTVQYGDNIRSICLLMGDYTWSSNILK 170
               |......|.:.....: |.:..|...|||||:||...:.:.|:||.:||......::|    
Zfish   371 ---YDPSRISRSVKAVIKH-PYYNPNTNDNDIALVRLSFPITFTDSIRPVCLAAEGSVFNS---- 427

  Fly   171 NLVKFNTTGWGRTESRIN------SP-VLQQASLTHHHLSYCAQVFG-KQLDKSHIC--VASSTG 225
                 :|..|..|...|:      || :.|:..:.......|..::| ..:..:.||  :.....
Zfish   428 -----DTESWITTWRNISDGVPLPSPKIFQEVEVPVIGNRQCNCLYGVGSITDNMICAGLLKEGK 487

  Fly   226 STCQGDSGGPLTARVRIGSERRV-ILFGVVSYGA--VHCFGPTVYTNVIHFANWIELHT 281
            ..||||||||:     :.::..| :..|:||:|:  .....|.|||.|..:..||...|
Zfish   488 DLCQGDSGGPM-----VSNQSSVWVQSGIVSFGSGCAQSEFPGVYTRVSRYQEWITYFT 541

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30287NP_726083.1 Tryp_SPc 41..277 CDD:214473 67/248 (27%)
Tryp_SPc 42..280 CDD:238113 69/251 (27%)
si:dkey-32n7.7XP_021335883.1 NIDO 4..63 CDD:310601
NIDO 141..272 CDD:322035
Tryp_SPc 309..537 CDD:238113 67/248 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.