DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30287 and LOC101733280

DIOPT Version :9

Sequence 1:NP_726083.1 Gene:CG30287 / 246530 FlyBaseID:FBgn0050287 Length:284 Species:Drosophila melanogaster
Sequence 2:XP_031752096.1 Gene:LOC101733280 / 101733280 -ID:- Length:421 Species:Xenopus tropicalis


Alignment Length:277 Identity:72/277 - (25%)
Similarity:115/277 - (41%) Gaps:62/277 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 RVINGKPADLFSNPWMVIIIERGMMK-----CGGSLITPRYVLTAAHCKSETKSQLT-------- 92
            |:|.|......:.|| .:.|:.|..|     ||||::..::|||||.|.::.|:.|.        
 Frog    28 RIIGGHHTQAGAWPW-AVSIQHGNGKDYTHFCGGSILNVKWVLTAASCFTKYKNSLNTLRLVFGA 91

  Fly    93 ---VRLGDY----DVNQAVDCSSYGCIPRPREINVTRTYVPSHYTNFRKNDIALLRLETTVQYGD 150
               .|||..    .:.|.:...:|..|.||                  .:||||:.||..::|.|
 Frog    92 HHLARLGPEVQFGKIKQLIIHENYSPIERP------------------THDIALVELEAAIKYND 138

  Fly   151 NIRSICLLMGDYTWSSNILKNLVKFN---TTGWG-RTESRINS-PVLQQASLTHHHLSYC--AQV 208
            ..:..|:        ..|..|:.:.:   .:.|| ..||...: .::|:|.:.......|  .|.
 Frog   139 YTQPACI--------PAITVNVEEKDDCYVSAWGFLNESPTETLTIMQEAQVNIIPKKTCNSKQW 195

  Fly   209 FGKQLDKSHICV--ASSTGSTCQGDSGGPLTARVRIGSERRVILFGVV--SYGAVHCFGPTVYTN 269
            :..::....:|.  .|....:|.||.|||||.| ||.:...::: |:.  .||......|.|||.
 Frog   196 YKGKIKDFSLCAHYTSENSDSCLGDVGGPLTCR-RIDAYTYMVV-GIAGSGYGCPKEKQPHVYTA 258

  Fly   270 VIHFANWI--ELHTKKN 284
            ..|:..||  :::..||
 Frog   259 TQHYIEWIGVKIYGDKN 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30287NP_726083.1 Tryp_SPc 41..277 CDD:214473 68/266 (26%)
Tryp_SPc 42..280 CDD:238113 69/270 (26%)
LOC101733280XP_031752096.1 Tryp_SPc 28..266 CDD:214473 68/266 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.