DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30287 and prss56

DIOPT Version :9

Sequence 1:NP_726083.1 Gene:CG30287 / 246530 FlyBaseID:FBgn0050287 Length:284 Species:Drosophila melanogaster
Sequence 2:XP_017949880.1 Gene:prss56 / 101731690 XenbaseID:XB-GENE-6051085 Length:665 Species:Xenopus tropicalis


Alignment Length:268 Identity:80/268 - (29%)
Similarity:123/268 - (45%) Gaps:54/268 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 RVINGKPADLFSNPWMVIIIERGMMKCGGSLITPRYVLTAAHCKSETKSQL--TVRLGDYDVNQA 103
            |::.|......|.||:|.|...|.:.|||.|:...::||||||.:.:.:::  ||.:|.||:.: 
 Frog    74 RIVGGSITSPGSWPWLVNIRFNGELMCGGVLLDDMWILTAAHCFTGSVNEVLWTVVVGQYDLTK- 137

  Fly   104 VDCSSYGCIPRPREINVTRTYVPSHYTNFRKNDIALLRLETTVQYGDNIRSICL--LMGDYTWSS 166
               ::.|  .:..::|...|:...:...| .||:|||.|.::|....:.|.:||  :..|.|..:
 Frog   138 ---NAQG--EKTFQVNRIVTHPKFNQKTF-DNDLALLELTSSVTASQSARPVCLPPVPRDPTPGT 196

  Fly   167 NILKNLVKFNTTGWGR-----------TESRINSPVLQQASLTHHHLSYCAQVFGK-QLDKSHIC 219
            |..       ..|||.           .|:|:  |||.|.:        |....|| .|..:..|
 Frog   197 NCY-------IAGWGSLYEDGPLSDVIMEARV--PVLSQEA--------CRSTLGKNMLTSTMFC 244

  Fly   220 VASSTG--STCQGDSGGPLTARVRIGSERRVILFGVVSYGAVHCFG------PTVYTNVIHFANW 276
            .....|  .:||||||||||.:..|  .::.:|:|:.|:|.    |      |.|||.|..|.:|
 Frog   245 AGYLNGGIDSCQGDSGGPLTCQDPI--SKQYVLYGITSWGD----GCGERGKPGVYTRVTAFTDW 303

  Fly   277 IELHTKKN 284
            |.....|:
 Frog   304 ISHQMNKS 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30287NP_726083.1 Tryp_SPc 41..277 CDD:214473 77/259 (30%)
Tryp_SPc 42..280 CDD:238113 78/261 (30%)
prss56XP_017949880.1 Tryp_SPc 75..305 CDD:238113 77/259 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.