DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30287 and LOC100495541

DIOPT Version :9

Sequence 1:NP_726083.1 Gene:CG30287 / 246530 FlyBaseID:FBgn0050287 Length:284 Species:Drosophila melanogaster
Sequence 2:XP_031749237.1 Gene:LOC100495541 / 100495541 -ID:- Length:659 Species:Xenopus tropicalis


Alignment Length:301 Identity:92/301 - (30%)
Similarity:135/301 - (44%) Gaps:55/301 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLLLIALVFLKVQGQPHLLDPQCVTAR----SEPGL-YRVINGKPADLFSNPWMVIIIERGMMKC 67
            :|..:.|.||.:...|||...: .||.    ..|.| .|::.|..|...:.||.|.:..:|:..|
 Frog     5 VLSFVTLTFLLLSFSPHLSLCRXTTAAPLVCGSPLLPNRIVGGSAATEGAWPWQVSLRYKGIHIC 69

  Fly    68 GGSLITPRYVLTAAHC--KSETKSQLTVRLGDYDVNQAVDCSSYGCIPRPREI--NVTRTYV--- 125
            |||:|...::||||||  .|::.|...||||.|.::          :..|.||  .|.|..|   
 Frog    70 GGSVIGTHWILTAAHCFLISQSPSDFEVRLGAYQLS----------LTSPNEITYKVDRIIVNSQ 124

  Fly   126 ---PSHYTNFRKNDIALLRLETTVQYGDNIRSICLLMGDYTWSSNILKNLVKFNTTGWGRTESRI 187
               .|||     .||||:|..:.:.|...|..:||     ..:||.....::...||||.|..::
 Frog   125 FDSSSHY-----GDIALIRPTSPITYTPYILPVCL-----PSTSNSFPEGMECWVTGWGTTAFQV 179

  Fly   188 NSP---VLQQASLTHHHLSYCAQVF--GKQLDKS-------HICVASSTG--STCQGDSGGPLTA 238
            |.|   .|||........:.|.|::  |..:..|       .||...:.|  .:|||||||||..
 Frog   180 NLPYPQTLQQVMTPLISRTSCDQMYHIGTNVPSSTAIIPSDQICAGYAAGQKDSCQGDSGGPLVC 244

  Fly   239 RVRIGSERRVILFGVVSY--GAVHCFGPTVYTNVIHFANWI 277
            ::: |...::   |.|::  |......|.|||.|..:.:|:
 Frog   245 KLQ-GIWYQI---GFVTWGDGCAIANRPGVYTLVPAYQSWL 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30287NP_726083.1 Tryp_SPc 41..277 CDD:214473 80/261 (31%)
Tryp_SPc 42..280 CDD:238113 80/262 (31%)
LOC100495541XP_031749237.1 Tryp_SPc 44..283 CDD:238113 80/262 (31%)
Tryp_SPc 362..595 CDD:238113
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.