DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30287 and tmprss15

DIOPT Version :10

Sequence 1:NP_726083.1 Gene:CG30287 / 246530 FlyBaseID:FBgn0050287 Length:284 Species:Drosophila melanogaster
Sequence 2:XP_031752048.1 Gene:tmprss15 / 100490249 XenbaseID:XB-GENE-999987 Length:994 Species:Xenopus tropicalis


Alignment Length:261 Identity:72/261 - (27%)
Similarity:112/261 - (42%) Gaps:52/261 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 RVINGKPADLFSNPWMVIIIERGMMKCGGSLITPRYVLTAAHC---KSETKSQLTVRLGDYDVNQ 102
            :::.|..|.|.:.||:|.:.......||.||:...::::||||   ::...|....|||.:    
 Frog   759 KIVGGSDAALGAWPWIVSLYYNDRQTCGASLVNQEWLVSAAHCVYGRNLIPSNWKARLGLH---- 819

  Fly   103 AVDCSSYGCIPRPREINVTRTYV-----------PSHYTNFRKNDIALLRLETTVQYGDNIRSIC 156
                         ..:|:|:..:           |.:....:.:||.::.|:..|.|.|.|:.||
 Frog   820 -------------TNLNLTQPQIATQMIDQIVINPQYNRRTKDSDIVMMHLQFKVNYSDYIQPIC 871

  Fly   157 LLMGDYTWSSNILKNLVKFNTTGWGRTESRINSP-VLQQAS---LTHHHLSYCAQVFGK-QLDKS 216
            |...|..:|..|     ..:..|||||:|....| :||:|.   :::|.   |.|...: .:..:
 Frog   872 LPETDQEFSVGI-----NCSIAGWGRTQSGGPVPNILQEAEIPLISNHK---CQQQMPEYNITDN 928

  Fly   217 HICVASSTG--STCQGDSGGPLTARVRIGSERRVILFGVVS--YGAVHCFGPTVYTNVIHFANWI 277
            .:|.....|  .|||||||||:..:    ......|.||.|  ||......|.||..|..|.|||
 Frog   929 MVCGGYEEGGIDTCQGDSGGPMMCQ----QNNEWFLVGVTSFGYGCAQPSRPGVYVRVTEFTNWI 989

  Fly   278 E 278
            :
 Frog   990 K 990

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30287NP_726083.1 Tryp_SPc 42..280 CDD:238113 72/260 (28%)
tmprss15XP_031752048.1 SEA 34..>103 CDD:460188
LDLa 157..190 CDD:197566
CUB 199..305 CDD:238001
MAM 321..478 CDD:459878
CUB 501..608 CDD:395345
LDLa 620..654 CDD:238060
SR 655..746 CDD:214555
Tryp_SPc 760..991 CDD:238113 72/260 (28%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.