DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30287 and zgc:163079

DIOPT Version :9

Sequence 1:NP_726083.1 Gene:CG30287 / 246530 FlyBaseID:FBgn0050287 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_001077051.2 Gene:zgc:163079 / 100006550 ZFINID:ZDB-GENE-030131-7428 Length:313 Species:Danio rerio


Alignment Length:269 Identity:76/269 - (28%)
Similarity:109/269 - (40%) Gaps:55/269 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 RVINGKPADLFSNPWMVIIIERGMMK--CGGSLITPRYVLTAAHCKS-ETKSQLTVRLGDYDVNQ 102
            ::|.|..|...|.||...|..:...:  ||||||...:|||.|...: ...|.:.|.||....|.
Zfish    35 KIIGGLNATQGSWPWQASINLKATEEFYCGGSLINKGWVLTTAKVFALMPASDIVVYLGRQTQNG 99

  Fly   103 AVDCSSYGCIPRPREINVTRTYVPSH--YTNFRKNDIALLRLETTVQYGDNIRSICL-------L 158
            :          .|.||:.|.|.:..|  |.:...| :|||:|.:.|.:.|.|:.:||       :
Zfish   100 S----------NPYEISRTVTKIIKHPNYNSLDSN-LALLKLSSPVTFSDYIKPVCLAAAGSVFV 153

  Fly   159 MGDYTWSSNILKNLVKFNTTGWG-----RTESRINSP-VLQQASLTHHHLSYCAQVFGKQLDKSH 217
            .|..:|            .||||     .|...|..| |||:......:...|...:|..:....
Zfish   154 DGTASW------------VTGWGYLNRPATVEEIMLPDVLQEVEAPIVNNFECNAAYGGIITNKL 206

  Fly   218 ICVA--SSTG-STCQGDSGGPLTAR---VRIGSERRVILFGVVSYGAVHCFG-PTVYTNVIHFAN 275
            :|..  :..| :.|.||.||||..:   :.|.|       |||..|.....| ||:|..|..:.:
Zfish   207 LCAGYLNEDGKAPCAGDVGGPLVIKQGAIWIQS-------GVVVSGYCGLPGYPTIYVRVSEYED 264

  Fly   276 WIELHTKKN 284
            ||..:|..:
Zfish   265 WISYYTNSS 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30287NP_726083.1 Tryp_SPc 41..277 CDD:214473 73/260 (28%)
Tryp_SPc 42..280 CDD:238113 75/262 (29%)
zgc:163079NP_001077051.2 Tryp_SPc 35..266 CDD:214473 73/260 (28%)
Tryp_SPc 36..267 CDD:238113 74/260 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.