DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30287 and LOC100004411

DIOPT Version :9

Sequence 1:NP_726083.1 Gene:CG30287 / 246530 FlyBaseID:FBgn0050287 Length:284 Species:Drosophila melanogaster
Sequence 2:XP_001343728.4 Gene:LOC100004411 / 100004411 -ID:- Length:494 Species:Danio rerio


Alignment Length:277 Identity:81/277 - (29%)
Similarity:121/277 - (43%) Gaps:77/277 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 RVINGKPADLFSNPWMVII---IERGMMKCGGSLITPRYVLTAAHCKSETKSQLTVRLGDYDVNQ 102
            |::.|:......:||.|::   .|.|.  ||||||..|:|:|||||..:|...:|:  ||||.  
Zfish   248 RIVGGQLQRQGGSPWQVLLRREDEYGF--CGGSLINQRWVITAAHCLQQTPHHITI--GDYDK-- 306

  Fly   103 AVDCSSYGCIPRP----REINVTRTYVPSHYTNFR-KNDIALLRLETTVQYGDNIRSICLLMGDY 162
                      .||    ::|.|.:.....||..:. .:|||||.|.:.|..|......||.    
Zfish   307 ----------MRPDKDEQKITVEKIIPHPHYHEYTFDSDIALLYLSSAVTLGPFASPACLP---- 357

  Fly   163 TWSSNILKNLVKFN----TTGWGRTE---------SRINSPVLQQAS--------LTHHHLSYCA 206
              .:|:.:.|:|..    .:|||.|.         .::..||::|.|        :|.:  .:||
Zfish   358 --DANLAERLMKPGEQGLVSGWGSTHYLQRSSRFLRKVQLPVVEQKSCINSTEQIITDN--MFCA 418

  Fly   207 QVFGKQLDKSHICVASSTGSTCQGDSGGPLTARVRIGSERRVILFGVVSYGAVHC-----FGPTV 266
            ....:::|            .|.||||||.....| |:   ..|.||||:|. .|     :|  |
Zfish   419 GFLMEEMD------------ACTGDSGGPFIVNYR-GT---WFLTGVVSWGE-RCASQGKYG--V 464

  Fly   267 YTNVIHFANWIELHTKK 283
            ||.:.::.:||:...||
Zfish   465 YTRLGNYLSWIQEEMKK 481

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30287NP_726083.1 Tryp_SPc 41..277 CDD:214473 77/269 (29%)
Tryp_SPc 42..280 CDD:238113 78/271 (29%)
LOC100004411XP_001343728.4 GLA 22..85 CDD:214503
EGF_CA 86..122 CDD:238011
FXa_inhibition 128..164 CDD:291342
Tryp_SPc 248..475 CDD:214473 77/269 (29%)
Tryp_SPc 249..477 CDD:238113 78/270 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.