DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30286 and CG9737

DIOPT Version :10

Sequence 1:NP_726082.3 Gene:CG30286 / 246529 FlyBaseID:FBgn0050286 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_651783.1 Gene:CG9737 / 43600 FlyBaseID:FBgn0039758 Length:424 Species:Drosophila melanogaster


Alignment Length:132 Identity:29/132 - (21%)
Similarity:41/132 - (31%) Gaps:62/132 - (46%)


- Green bases have known domain annotations that are detailed below.


  Fly   482 GCNPDEP----EYYTAKDLHIGATVVVFAHRFKIVSADLYVYRYMQAYPEIFSPIAIDSVRNFLL 542
            |.:.|:|    |.:||.         :..|   |::..||.:.|...|                 
  Fly   294 GTDKDDPMKLIEIHTAN---------MIQH---ILNGLLYRFNYTAGY----------------- 329

  Fly   543 AEGHL-----------------KDDLRR-----ATEEEYQ------KLEQSDGPSEQGEVQKRLA 579
             .||.                 :|.:||     |.|..||      |:...:.|.|:.|.|..|.
  Fly   330 -HGHHEQGDRQGNKEGGYYAIGRDGIRRGVSYKANEFGYQPHIKFEKVSPEETPREETEKQAGLK 393

  Fly   580 GF 581
            ||
  Fly   394 GF 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30286NP_726082.3 Tryp_SPc 39..269 CDD:238113
CG9737NP_651783.1 CLIP 28..89 CDD:463440
Tryp_SPc 149..406 CDD:214473 29/132 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.