DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30286 and tpr

DIOPT Version :10

Sequence 1:NP_726082.3 Gene:CG30286 / 246529 FlyBaseID:FBgn0050286 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_611611.1 Gene:tpr / 37486 FlyBaseID:FBgn0034661 Length:372 Species:Drosophila melanogaster


Alignment Length:159 Identity:36/159 - (22%)
Similarity:47/159 - (29%) Gaps:76/159 - (47%)


- Green bases have known domain annotations that are detailed below.


  Fly   567 GPSEQGE-----VQKRLAG-----------------FQIGDSN----GASPAPIASPRASPVP-- 603
            ||..||.     :|||..|                 .|:..||    .|:.|...:|...|:|  
  Fly    16 GPYAQGAPALKMMQKRYVGLHQWLSPMCATKDLKEHLQLFRSNPGLTAANSAVPGAPNGQPLPQS 80

  Fly   604 ------------------YGDAQAAPF-----------------AEPPEHPCPHPIIPDEELRKA 633
                              |...||.|:                 |..|::..|.|       ...
  Fly    81 ALSLSAAQQQQFLQHNAAYAAQQAPPYVINPGQDPNQYMGALIAAGVPQYYAPAP-------WGV 138

  Fly   634 YHTNEPDELAI-QAYNVPEDP-TSSRQGS 660
            |    |..||| |..:.|..| |.|:||:
  Fly   139 Y----PANLAIPQQQSQPRRPLTPSQQGA 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30286NP_726082.3 Tryp_SPc 39..269 CDD:238113
tprNP_611611.1 Tryp_SPc 127..356 CDD:238113 15/48 (31%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.