DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30286 and Hayan

DIOPT Version :9

Sequence 1:NP_726082.3 Gene:CG30286 / 246529 FlyBaseID:FBgn0050286 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_001097020.1 Gene:Hayan / 32831 FlyBaseID:FBgn0030925 Length:637 Species:Drosophila melanogaster


Alignment Length:228 Identity:68/228 - (29%)
Similarity:110/228 - (48%) Gaps:33/228 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 CGGTLVNHRFILTAAHCIREDENLT--VRLGEFNSLTSIDCNGSDCLPPSEDFE-IDVAFRHGGY 121
            |||:|:..||:||||||:..|::..  ||||..|.        .:..|..:|.. |||.. |..|
  Fly   414 CGGSLIASRFVLTAAHCVNSDDSTPSFVRLGALNI--------ENPEPGYQDINVIDVQI-HPDY 469

  Fly   122 SRTNRIHDIGLLRLAKSVEYKVHIKPICLITNTTLQPKIERLHRLVATGWG--RSPSEAANHILK 184
            |.:::.:||.:|:||:..:....|:|.||.|:.:..|   ..::....|||  ...:.|.:.||.
  Fly   470 SGSSKYYDIAILQLAEDAKESDVIRPACLYTDRSDPP---ANYKYFVAGWGVMNVTNRAVSKILL 531

  Fly   185 SIRVTRVNWGVCSKTYWVD-------RR---RDQICVS--HESGVSCSGDSGGPMGQAI-RLDGR 236
            ...:..|....|:.::...       ||   ..|:|.:  ::...:|.||||||:...| .:|| 
  Fly   532 RAALDLVPADECNASFAEQPSANRTLRRGVIASQLCAADKNQRKDACQGDSGGPLILEIDDVDG- 595

  Fly   237 VLFVQVGIVSYG-NAECLSPSVFTNVMEHIDWI 268
             .:..||::|.| .....:|.::|.|...:|:|
  Fly   596 -TYSIVGVISSGFGCATKTPGLYTRVSSFLDYI 627

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30286NP_726082.3 Tryp_SPc 39..269 CDD:238113 68/228 (30%)
Tryp_SPc 39..268 CDD:214473 67/226 (30%)
HayanNP_001097020.1 CLIP 32..80 CDD:197829
Tryp_SPc 384..627 CDD:214473 67/226 (30%)
Tryp_SPc 385..630 CDD:238113 68/228 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437477
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.