DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30286 and F9

DIOPT Version :10

Sequence 1:NP_726082.3 Gene:CG30286 / 246529 FlyBaseID:FBgn0050286 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_032005.1 Gene:F9 / 14071 MGIID:88384 Length:471 Species:Mus musculus


Alignment Length:238 Identity:68/238 - (28%)
Similarity:108/238 - (45%) Gaps:38/238 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 PWMAYLHKSGELVCGGTLVNHRFILTAAHCIREDENLTVRLGEFNSLTSIDCNGSDCLPPSEDFE 111
            ||...|:...|..|||.::|.::|:|||||::..:.:.|..||:|            :...||.|
Mouse   249 PWQVILNGEIEAFCGGAIINEKWIVTAAHCLKPGDKIEVVAGEYN------------IDKKEDTE 301

  Fly   112 ----IDVAFRHGGYSRT-NRI-HDIGLLRLAKSVEYKVHIKPICL----ITNTTLQPKIERLHRL 166
                :.....|..|:.| |:. |||.||.|.|.:....::.|||:    .||..|     :....
Mouse   302 QRRNVIRTIPHHQYNATINKYSHDIALLELDKPLILNSYVTPICVANREYTNIFL-----KFGSG 361

  Fly   167 VATGWGRSPSEAAN-HILKSIRVTRVNWGVCSKTYWVDRRRDQICVSHESG--VSCSGDSGGPMG 228
            ..:|||:..::... .||:.:||..|:...|.::.......:..|..:..|  .||.||||||  
Mouse   362 YVSGWGKVFNKGRQASILQYLRVPLVDRATCLRSTTFTIYNNMFCAGYREGGKDSCEGDSGGP-- 424

  Fly   229 QAIRLDGRVLFVQVGIVSYGNAECLSP---SVFTNVMEHIDWI 268
            ....::|....  .||:|:|. ||...   .::|.|..:::||
Mouse   425 HVTEVEGTSFL--TGIISWGE-ECAMKGKYGIYTKVSRYVNWI 464

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30286NP_726082.3 Tryp_SPc 39..269 CDD:238113 68/238 (29%)
F9NP_032005.1 GLA 28..92 CDD:214503
EGF_CA 93..129 CDD:238011
FXa_inhibition 134..170 CDD:464251
Tryp_SPc 237..467 CDD:238113 68/238 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.