DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30281 and Fibcd1

DIOPT Version :9

Sequence 1:NP_726164.1 Gene:CG30281 / 246525 FlyBaseID:FBgn0050281 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_849218.2 Gene:Fibcd1 / 98970 MGIID:2138953 Length:459 Species:Mus musculus


Alignment Length:305 Identity:124/305 - (40%)
Similarity:159/305 - (52%) Gaps:44/305 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 CVLILSGGSL----LSTAQSNKLDLVYKKAES------MVSSLKIRLE---------------EL 46
            |..:..|.||    |||.||.:..|:...:||      :|:|:...||               :|
Mouse   156 CAGLRKGHSLLGQGLSTLQSEQGRLIQLLSESQGHMAHLVNSVSDVLEALQRERGLGRPRVKADL 220

  Fly    47 KQSYKEITEERGSHETINPSSC---LAAGINSNGIHVIEVPGLEP--FPVYCDTRLAGSGWTVIQ 106
            :::.......||......|..|   |.:|...:|::.| .|...|  |.||||.|..|.||||.|
Mouse   221 QRAPSRGARPRGCANGSRPRDCLDVLLSGQQDDGVYSI-FPTHYPAGFQVYCDMRTDGGGWTVFQ 284

  Fly   107 RRQDGSENFYRCWEEYSQGFGELSGEFFMGLEKLHFLTTAEPYELFVYMEDF-NGVVHDARYEDF 170
            ||:|||.||:|.||.|.:|||:|:||.::||:::|.|||...|||.|.:||| ||..: |.|..|
Mouse   285 RREDGSVNFFRGWEAYREGFGKLTGEHWLGLKRIHALTTQAAYELHVDLEDFDNGTAY-AHYGSF 348

  Fly   171 AIGNASA-----SYALSVLGKYSGDAGDSLRYHKGMPFSTFDHDD--TGHGCARIYVGAWWYDQC 228
            .:|..|.     .|.|:| ..|||.|||||..|.||.|:|.|.|.  :.:.||..|.|||||..|
Mouse   349 GVGLFSVDPEEDGYPLTV-ADYSGTAGDSLLKHSGMRFTTKDRDSDHSENNCAAFYRGAWWYRNC 412

  Fly   229 QRSNLNGQYLEGGRFEPKMSGRGITWMSWRGYDYGYKFVQMMIRP 273
            ..||||||||.|..   .....|:.|.||.|:.|..||.:|.|||
Mouse   413 HTSNLNGQYLRGAH---ASYADGVEWSSWTGWQYSLKFSEMKIRP 454

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30281NP_726164.1 FReD 63..274 CDD:238040 105/224 (47%)
Fibcd1NP_849218.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..22
FReD 239..455 CDD:238040 105/222 (47%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 187 1.000 Domainoid score I3330
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H122246
Inparanoid 1 1.050 189 1.000 Inparanoid score I3887
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 1 1.000 - - otm43923
orthoMCL 1 0.900 - - OOG6_100073
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
109.760

Return to query results.
Submit another query.