DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30281 and ANGPTL1

DIOPT Version :10

Sequence 1:NP_726164.1 Gene:CG30281 / 246525 FlyBaseID:FBgn0050281 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_004664.1 Gene:ANGPTL1 / 9068 HGNCID:489 Length:491 Species:Homo sapiens


Alignment Length:206 Identity:84/206 - (40%)
Similarity:121/206 - (58%) Gaps:5/206 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 AGINSNGIHVIEVPGLE-PFPVYCDTRLAGSGWTVIQRRQDGSENFYRCWEEYSQGFGELSGEFF 134
            ||.:.:||::|:..... |..::|:..|...||||||:|.|||.||:|.||.|.:|||.:.||::
Human   286 AGHSVSGIYMIKPENSNGPMQLWCENSLDPGGWTVIQKRTDGSVNFFRNWENYKKGFGNIDGEYW 350

  Fly   135 MGLEKLHFLTTAEPYELFVYMEDFNGVVHDARYEDFAIGNASASYALSVLGKYSGDAGDSLRYHK 199
            :|||.::.|:..:.|:|.:.:||::.....|.|..|.:...|..|.|. ||.|.|:||||:.:|.
Human   351 LGLENIYMLSNQDNYKLLIELEDWSDKKVYAEYSSFRLEPESEFYRLR-LGTYQGNAGDSMMWHN 414

  Fly   200 GMPFSTFDHDDTGH--GCARIYVGAWWYDQCQRSNLNGQYLEGGRFEPKMSGRGITWMSWRGYDY 262
            |..|:|.|.|...:  .||..:.|.|||:.|..|||||.:..||.:..|... ||.|..:||..|
Human   415 GKQFTTLDRDKDMYAGNCAHFHKGGWWYNACAHSNLNGVWYRGGHYRSKHQD-GIFWAEYRGGSY 478

  Fly   263 GYKFVQMMIRP 273
            ..:.|||||:|
Human   479 SLRAVQMMIKP 489

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30281NP_726164.1 FReD 63..274 CDD:238040 84/206 (41%)
ANGPTL1NP_004664.1 PB1 74..138 CDD:413452
FReD 275..490 CDD:238040 84/206 (41%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.